KEGG   Frankia sp. EuI1c: FraEuI1c_5991Help
Entry
FraEuI1c_5991     CDS       T01354                                 

Definition
(GenBank) PKD domain containing protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7373379..7374122
Genome map
AA seq 247 aa AA seqDB search
MEQLPAARTARWFAEQRVRAVGRAERLVRGTSSRLRLAGVGLAAVGVTAAVTIAGCAPPG
GIVTSHPSPSARPLHAALSVAKIGCDDSGGTAKLDASGTTGGAGPLTYAFAFGDGTTAAA
ASTATTNHLYARNGPFTATVTVRDASGATATATATVTLLHLAASPTSVTVGQSVTFTATG
ICAGARIDLNSGGYAGYYYGEPNAHNFWEDNPYTTTFSAPGTLHYSAHWSEINPYSDSNV
VAITVTA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaactccccgccgcgcgaaccgccaggtggttcgccgagcagcgtgtccgggcc
gtgggcagagccgagcggctcgtccgcggcacgtcgagccgcttacgccttgccggagtc
ggcctggccgccgtgggcgtcaccgccgccgtgacgatcgcgggctgcgcgcctcccggc
ggcatcgtcacgtcgcacccgtcgccgtcggccagaccgctgcacgccgccctgtcggtg
gcgaaaatcggctgcgacgactccggcgggacggccaagctggacgcctcgggaacgacc
ggtggggccggtccgctgacctacgcgttcgccttcggcgacggaacgaccgcggccgcc
gcctcaacggcgaccacaaaccacctgtacgccaggaacgggccgttcacggcgaccgtg
acagtgcgcgacgcgtccggcgccacggccacggcgaccgccaccgtcaccttgctccac
ctcgccgcgagcccgacgtcggtaacggtcgggcagtccgtgacgttcaccgccaccggc
atctgcgcgggcgctcgcatcgacctgaattcgggcggctatgccggttactactacggt
gaacccaacgcccacaacttctgggaggacaacccttacacgaccaccttcagcgcccca
gggacgctgcactacagcgcccactggtcggagatcaatccgtattcggactccaacgtc
gtggcgataaccgtgaccgcctag

DBGET integrated database retrieval system