KEGG   Frankia sp. EuI1c: FraEuI1c_5999Help
Entry
FraEuI1c_5999     CDS       T01354                                 

Definition
(GenBank) amidohydrolase 2
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7382369..7383544
Genome map
AA seq 391 aa AA seqDB search
MAKLADGLRVIDADSHMTERHDLFTERAPKGYEDRVPHVEQVDGKPMWVIDGKTFGKAGS
GGTVDHDGKKHAFRASQGGSWTIDDVHPAAWDAAERLRLMDELGINAQVLYPNEIGIGGQ
NLRNSVRDEVLLRLCVELYNDAMADVQEQSGNRLLPMPIMPAWSIDDCVREAQRCAAQGA
RGVNMTADPQDSGSPDLGDHAWDPFWEVCAGLNLPVHFHIGASQTALAYFGTTFWPSQDH
YVKPAIGGASLFQNNSRVLLNSAYSGMFDRHPTLQMVSVESGIGWVPFMLEAMDYELLEN
APAWAKKLQKTPSEYFQSNWYATFWFETGRGDLQHLIDQVGEDRIMFETDFPHPTCLHPS
PIEQVSDTIATLRPQTQLKVMGGNAAQLYRV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagctggccgacggtctgcgagtgatcgacgccgactcgcacatgaccgagcgt
cacgatctcttcacggaacgggcgccgaagggctacgaggatcgcgtgccgcacgtcgag
caggtcgacggaaagcccatgtgggtgatcgacggcaagacgttcggcaaggcgggctcg
ggcggcactgtcgaccacgacgggaagaagcacgcgttccgcgcgtcccagggcgggtcc
tggaccattgacgacgtgcaccccgccgcgtgggacgcggcggagcgcctgcgcctcatg
gacgagttgggcatcaacgcgcaggtcctctacccgaacgagatcggcatcggcggtcag
aacctgcgcaactcggtgcgggacgaggtgctgctgcggctctgcgtcgagctctataac
gacgcgatggccgatgtgcaggagcagtcgggcaaccggctgctgccgatgccgatcatg
ccggcgtggagcatcgacgactgcgtccgggaggcccagcgctgcgccgcgcagggcgcc
cggggtgtcaacatgaccgccgacccccaggactccgggtcgccggacctcggtgaccac
gcgtgggacccgttctgggaggtgtgcgcggggctcaacctgccggtgcatttccacatc
ggcgccagccagacggcactcgcctacttcggcacgaccttctggccgagccaggaccac
tacgtcaagcccgcgatcggcggcgcctcgctgttccagaacaactcgcgcgtgctgctc
aacagcgcctactcgggaatgttcgaccggcaccccaccctgcagatggtgtccgtcgag
tccggcatcggctgggttccgttcatgctcgaggcgatggactacgagttgttggagaac
gcccccgcctgggcgaagaagctccagaagacgccgtccgaatacttccagagcaactgg
tacgccacgttctggttcgagaccggccgcggcgaccttcagcacctcatcgaccaggtc
ggcgaggacaggatcatgttcgagaccgacttcccgcacccgacctgcctgcacccgagc
ccgatcgagcaggtcagcgacacgatcgccaccctgcgcccgcagacccagctgaaggtc
atgggcggcaacgcggcccagctctaccgagtctga

DBGET integrated database retrieval system