KEGG   Frankia sp. EuI1c: FraEuI1c_6005Help
Entry
FraEuI1c_6005     CDS       T01354                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7389850..7390956
Genome map
AA seq 368 aa AA seqDB search
MKVLVVGGTGPTGPHVLDGLLRRGDEVTIFHRGTHEPAGLPDVEHLHGDPHFRASIDDAI
GARTFDVVVAMYGRLKHLAPALAGRCDQFVAIGGVPVYQGFFPDPGQSPLPVPVTEEHPV
VVDGAGGAELAFSRRLADAETAVFAHHPRATVLRFPTLFGPNNARPAEWSVIKRVRDRRP
FLILPDGGHQIHTRCAAANAAAFVLAALDAPEAAAGQVYNAGEATSWSFRDWATTITRLL
GHDLELVSVPRAIAIEATTSLLPLAGTTATHVVVSTEKARRELGYTPAVDPLDAMAELVA
WYDDHPDFDPAASPSFTDRFDYTTEDALLHHYRAATRQLAKVVEQNAAPPIHSMPHPQRP
GEVDHRGR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgctggtggtaggaggcaccgggcctaccggaccgcacgtgctcgacggcctg
ctgcggcgcggcgacgaggtcacgatcttccatcggggcacccacgagccagcgggactg
cccgatgtcgagcacctccacggcgatccccacttccgcgcgtcgatcgacgacgcgatc
ggcgcgcggacgttcgacgtcgtggtggccatgtatggccggctgaagcatctggcgccg
gcgctggccggcaggtgcgaccagttcgtcgccatcggtggggtgcccgtgtaccagggg
ttcttcccggacccaggtcagagcccgctaccggttccagtcaccgaggagcacccggtc
gtcgtcgacggcgcgggcggtgccgaactggccttctccaggcgcctcgccgacgccgag
acggccgtcttcgcgcatcatccgcgggcgaccgtcctgcgcttcccgacgctgttcggg
ccgaacaacgcgcggccggccgagtggtcggtcatcaagcgggtgcgcgaccggcggcct
ttcctgatccttcccgacggcggccatcagatccacacccggtgcgccgccgcgaacgcg
gccgcgttcgtgctcgcggccctggacgcgcccgaagcggccgccggccaggtctacaac
gcgggcgaggcgacaagctggtcgttccgggactgggccaccacgatcacccggctcctc
gggcacgacctggagctggtctccgtcccccgagcgatcgccatcgaggcgaccacctcg
ctgctccctctggccggcaccacggcgacgcacgtcgtcgtcagcaccgagaaggcacgc
cgcgagctgggttacacccccgccgtcgacccactcgacgcgatggccgaactcgtcgcc
tggtacgacgaccaccccgatttcgacccggccgccagcccgtccttcaccgaccggttc
gactacacgacggaggacgccctgctccaccattaccgggcggccacgcggcaactggcc
aaggtagtggaacaaaacgccgccccgcccattcacagcatgcctcatccacaaaggccc
ggcgaagtcgaccaccgcggccgctga

DBGET integrated database retrieval system