KEGG   Frankia sp. EuI1c: FraEuI1c_6007Help
Entry
FraEuI1c_6007     CDS       T01354                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7392501..7393400
Genome map
AA seq 299 aa AA seqDB search
MASTFDLGLVGKAAVVTGAGAGIGQAIARGLAAAGVRVGLVEIDPSRAAASAELIAKEGG
TALPLQADVMDTAALGAAITAAHAEFGRLDILVNNAGGVKGTRFLDQSERSWRRHIDINL
VSMLAATATAAPLIARTVAASGPVNASRRSGGSIVNITSIEGTRAAPMFAVYAACKAGMI
NFTRTMALELAESGIRINALAPDVTATAGLRGIMHGPVDPDALPAPAPGLFPGLDRYVPL
GREGVAAEIADAAVFLCSDQAAYITGTTLSVDGGTAASAGWLRSGAGWTLQGEQSGAGA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcgacttttgatctcggcctcgtgggcaaggccgcggtggtcacgggagcgggt
gccggcatcgggcaggccatcgcgcgcgggctggccgcggccggagtgcgcgtcgggctc
gtcgagatcgatccgagccgggcagcggcgtccgccgagctgatcgcgaaggagggcggc
acggctctccccctgcaggcggacgtcatggacaccgcggcgctcggcgcggccatcacc
gcggcccacgccgagttcggccgcctggacatcctggtgaacaatgccggcggcgtgaag
gggacccggttcctcgaccagagcgagcggagctggcgccggcacatcgacatcaacctc
gtcagcatgctggccgcgaccgcgacggcggccccgctgatcgcgcggaccgtcgccgcg
tccggcccggtcaacgcctctcgccgtagcggtgggtcgatcgtcaacatcaccagcatc
gagggcacccgcgccgccccgatgttcgccgtctacgcggcctgcaaggctggaatgatc
aatttcacccgcacgatggcgctggagctcgccgagtccggcatccgcatcaacgcgctc
gcgcccgacgtgaccgcgaccgccggcctgcgcggcatcatgcacggaccggtcgacccc
gatgcgctgcccgcgcccgctcccgggctcttcccgggactcgaccgttacgtcccgctg
ggccgggagggggtcgcggccgagatcgcggacgccgcggtcttcctgtgctccgaccag
gccgcctacatcaccggcaccaccctgagcgtggacggcggaaccgccgcctccgccggc
tggctccgctccggcgccggctggaccctccagggcgaacagtccggcgccggagcgtag

DBGET integrated database retrieval system