KEGG   Frankia sp. EuI1c: FraEuI1c_6013Help
Entry
FraEuI1c_6013     CDS       T01354                                 

Definition
(GenBank) SsrA-binding protein
  KO
K03664  
SsrA-binding protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7400207..7400686)
Genome map
AA seq 159 aa AA seqDB search
MAKETGRKNIAQNRRARHEYDILDTYEAGVVLTGTEVKSLRMGRASLVDGFAQIENGEVW
LHAVHIPEYTEGTWTNHAPRRKRKLLLHRDEIEKLVGKTKEGGLTLVPLALYWKDGRAKI
EIALARGRKSYDKRHALAEKDAKREMSRIMGRQAKGRFS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggagaccgggcgcaagaacatcgcgcagaaccggcgggcgcggcatgagtac
gacatcctcgacacctacgaggccggggtcgtgctcacgggcaccgaggtcaagtcgctg
cggatgggccgggcttccctggtcgacgggttcgcgcagattgagaacggcgaggtctgg
ctgcacgccgtccacatcccggagtacaccgagggaacctggacgaaccacgctccgcgg
cgcaagcgcaagctgctgctgcaccgcgacgagatcgagaagctggtcggcaagacgaag
gaaggcggcctgacgctcgtgccgctcgccctctactggaaggacggccgggccaagatc
gagatcgcgttggcccgcggccgcaagtcctacgacaagcggcacgccctggccgagaag
gacgcgaagcgggagatgtcccggatcatgggccgtcaggcgaagggccgcttcagctga

DBGET integrated database retrieval system