KEGG   Frankia sp. EuI1c: FraEuI1c_6014Help
Entry
FraEuI1c_6014     CDS       T01354                                 

Definition
(GenBank) protein of unknown function DUF214
  KO
K09811  
cell division transport system permease protein
Organism
fri  Frankia sp. EuI1c
Pathway
ABC transporters
Module
Cell division transport system
Brite
KEGG Orthology (KO) [BR:fri00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    FraEuI1c_6014
Chromosome [BR:fri03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    FraEuI1c_6014
Transporters [BR:fri02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    FraEuI1c_6014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7400882..7401754)
Genome map
AA seq 290 aa AA seqDB search
MRIGPLLAILGAGLRRNLAVTSAVVITAAVCLAMLGAGLLLRAEVHTIDGYLLDQLEVVI
DLSDGITPAQRAALISDLKADPTVVDVRYENKQQVYDRFERDFRASPDVVSGVTAADLPA
ALRLRLVDPRDGDQIVLGYTGRDGVEAVRDQHALLSPLYRMLDGFSVAAFVLAAVQAAAS
GLLIYTMIRVSAHSRRRETAIMRLVGATNATVRAPFVLECALSGLIGGAVAAGALVAAKA
FLVDGRFAHQTMFPLFGWDAVWVAVAAVMAVGALAAAAMGSLALRRHLHA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatcgggccgctgctcgcgattctcggcgcggggctgcggcgcaacctggcggtg
acctcggcggtggtcatcacggccgcggtctgcctggcgatgctcggcgccggcctgctg
ctgcgcgccgaggtccacacgatcgacggctacctgctcgaccagctggaggtcgtcatc
gacctctccgacggcatcacccctgcccagcgcgccgccctgatctccgacctgaaggcc
gacccgaccgtggtcgacgtccggtatgagaacaagcagcaggtgtacgaccggttcgag
cgggacttccgggcgtcccccgatgtcgtgtccggggtgacggccgccgacctgcccgcc
gcgctgcgcctgcgcctggtcgatccgcgggacggcgaccagatcgtgctggggtacacc
ggccgcgacggggtcgaggcggtccgcgaccagcacgcgctgctcagcccgctgtaccgg
atgctcgacgggttcagcgtcgccgcgttcgtgctcgccgccgtgcaggcggccgcgtcg
ggcctgctgatctacacgatgatccgtgtctccgcgcactcccggcgccgggagacggcc
atcatgcgcctggtcggggcgacgaacgcgacggtccgggcgccgttcgtgctggaatgc
gcgctgtcggggctgatcgggggtgccgtggcggctggcgcgctcgtcgcggccaaggcg
ttcctggtcgacgggcggttcgcccatcagacgatgttcccgctgttcggctgggacgcg
gtctgggtcgcggtggccgcggtcatggcggtcggcgccctcgccgcggccgcgatgggc
agccttgccctgcgccgtcacctgcacgcctga

DBGET integrated database retrieval system