KEGG   Frankia sp. EuI1c: FraEuI1c_6015Help
Entry
FraEuI1c_6015     CDS       T01354                                 

Definition
(GenBank) cell division ATP-binding protein FtsE
  KO
K09812  
cell division transport system ATP-binding protein
Organism
fri  Frankia sp. EuI1c
Pathway
ABC transporters
Module
Cell division transport system
Brite
KEGG Orthology (KO) [BR:fri00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    FraEuI1c_6015
Chromosome [BR:fri03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    FraEuI1c_6015
Transporters [BR:fri02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    FraEuI1c_6015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7401754..7402488)
Genome map
AA seq 244 aa AA seqDB search
MIRLDAVTMTYPAGSRPALRDVTLRIDAGEFVFLVGPSGSGKSTLLRLLLREERATSGLV
ALDGVDLAAIPDRRVPLLRRTIGCVFQDFRLLPDRTVAGNVAFALDVVGRPRHVVRTVVP
EVLGLVGLAGKENRYPDELSGGEQQRVAVARAMVGRPRVLLADEPTGNLDPATSEGIMRL
LDAVNRTGTTVVMATHNAALVDARRRRVVELADGVCVRDEQRGAYDGEDTGEVPLPANET
AGVR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatccggctcgacgcggtgacgatgacgtacccggccgggagcaggccggcactgcgc
gacgtcaccctgcgcatcgacgccggggagttcgtcttcctggtcggaccgtccggctcg
ggcaagtcgaccctgctgcgcctgctgctgcgggaggaacgcgcgaccagcggcctggtc
gccctcgacggggtggacctcgcggcgatccccgaccggcgggtgccgctgctgcgccgg
accatcggctgcgtcttccaggactttcggctgctgccggaccggaccgtcgccgggaac
gtcgccttcgcgctcgacgtcgtcggccgcccgcggcacgtggtgcgcacggtcgttccc
gaggtactcggactcgtgggcctcgcgggcaaggagaaccgttaccccgacgagctgtcc
ggcggcgagcagcaacgggtcgcggtggcccgggcgatggtcgggcggccccgggtgctg
ctcgccgacgagccgaccggcaacctcgacccggcgaccagcgaggggatcatgcggctg
ctcgacgcggtcaaccggaccgggacgaccgtcgtcatggccacccacaacgccgcgctg
gtcgacgcccgccgccgccgggtcgtcgaactcgccgacggggtctgcgtccgggacgag
cagcgcggcgcctacgacggcgaggacaccggcgaggtgcctctgccggcgaatgagacg
gctggggtgcgctag

DBGET integrated database retrieval system