KEGG   Frankia sp. EuI1c: FraEuI1c_6029Help
Entry
FraEuI1c_6029     CDS       T01354                                 

Definition
(GenBank) Type II secretion system F domain protein
  KO
K12510  
tight adherence protein B
Organism
fri  Frankia sp. EuI1c
Brite
Secretion system [BR:fri02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   FraEuI1c_6029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7414319..7415176)
Genome map
AA seq 285 aa AA seqDB search
MGIFVGLLFGLGMFLIVGPRAPRRRSAAEPGWRRSTTELLAQAGVRGLGPGQFVAVSVAI
GVVVGFVIFAVTATWSLGFAFFVFAAFLPRTLVARRRRARMADLRGMWPDVVDNLASAVR
AGMSLPEGLAAVGQRGPAPLRGAFTRFGEEYRASGSFSSCLDKLADELADPVADRIIESL
RLAREVGGTDLGRLLRTLSTFLREDARTRAELETRQSWTVNAARLALAAPWVVLLLLATR
GQNVSAYDSPTGVAVLVGGGAVSVFAYVVMKRIGRLPEEGRVLRP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggatcttcgtggggctgctgttcgggctcgggatgtttctgatcgtcgggccgagg
gcgccgcggcgacggagcgccgcggagcccggctggcggcggtccaccaccgagctgctc
gcgcaggcgggggtgcggggcctgggcccgggccagttcgtcgcggtgagcgtcgccatc
ggcgtcgtcgtcgggttcgtcatcttcgccgtcacggcgacgtggtcgctcgggttcgcg
ttcttcgtgttcgccgcgttcctgccgcgaaccctggtcgcccgccgtcgtagggcccgg
atggcggacctgcgcgggatgtggcccgacgtcgtcgacaacctggcgagtgccgtgcgt
gcgggcatgtcgctgcccgaaggcctcgccgccgtcggccagcgtggcccggcgccgctg
cgcggggcgttcacccggttcggcgaggagtaccgggccagcggctcgttcagctcctgc
ctggacaagctcgcggacgagctcgccgatccggtggccgaccggatcatcgagtcgctg
cggctggccagggaggtcggtggcaccgacctcggccggctgctgcgcaccctgtcgacg
ttcctgcgcgaggacgcccgcacccgggccgagctggagacccggcagagctggaccgtc
aacgccgcgcgcctcgccctcgccgcgccctgggtggtgctgctcctgctggccacccgc
ggccagaacgtgtccgcctacgacagccctaccggcgtcgcggtgctcgtcggaggcggt
gccgtgtcagtgttcgcctacgtcgtgatgaagcgcattggccgacttcctgaagaaggg
cgggtgctgcgcccatga

DBGET integrated database retrieval system