KEGG   Frankia sp. EuI1c: FraEuI1c_6030Help
Entry
FraEuI1c_6030     CDS       T01354                                 

Definition
(GenBank) type II secretion system protein E
  KO
K02283  
pilus assembly protein CpaF
Organism
fri  Frankia sp. EuI1c
Brite
Secretion system [BR:fri02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   FraEuI1c_6030
Bacterial motility proteins [BR:fri02035]
 Pilus system
  Pilus assembly proteins
   FraEuI1c_6030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7415208..7416587)
Genome map
AA seq 459 aa AA seqDB search
MRLDEERRTLVAAVRGGPYPAGLGAGPGPAGGLGAGAPAGWPDAASLVENEVRELVRRRA
LDPAREPVVVRRLVDDVLGDYEERVLTSDLPPIVDRELVARLVYDAVAGFGPLQRHLDDP
AVEEIWINEPGRVFIARHGRSELTTTILTGDQVQDLVERMLKTSGRRVDLSTPFVDAMLP
DGSRLHVVIPDVTRLHWSVNIRKFILSASSLDELVAKGTLPPSAAAFLEASVIAGLNIII
AGGTQAGKTTMLNCLGSAIPARERVISCEEVFELRLRAPDWVAMQTRQANLEGTGEIRLR
RLIKEALRMRPDRLLVGEVRQEEALDLLIALNSGLPGMCSLHANSAREAVTKLCTLPLLA
GENVSHNFVVPTVAASVDLVVHLIKDAHGRRRVTEIVALPGRAEGDVVEVAQIFRSYGDT
LVRAEGYPPHPDRFARAGYDLAALLAPPDRGWPEIAVER
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcctggacgaggagcggcggactctcgtggcggcggtacggggtggcccttacccg
gctgggctgggcgccggcccaggcccggcaggcggcctgggtgccggcgcgccggccggc
tggccggacgcggcgtctctggtggagaacgaggtccgggagctggtccggcgccgggcg
ctcgacccggcgcgggagccggtcgtggtgcgccggctggtcgacgacgtgctcggcgac
tacgaggagcgcgtgctcaccagcgacctgccgcccatcgtcgatcgtgagctggtcgcc
cggctggtctacgacgcggtcgccggcttcgggccgctgcagcgccacctcgacgacccg
gccgtcgaggagatctggatcaacgagccgggccgggtgttcatcgcccgtcatggccgc
agcgagctcaccaccacgatcctcaccggcgaccaggtgcaggacctggtcgagcggatg
ctgaagacctccgggcgccgggtggacctctcgaccccgttcgtggacgcgatgctcccg
gacggctcgcggctgcacgtcgtcatcccggacgtgacccgcctgcactggtccgtcaac
atccgcaagttcatcctctcggcgtccagccttgacgagctggtggccaagggaacgctc
ccgccatcggccgcggccttcctggaggcgtcggtcatcgccggtctgaacatcatcatc
gccggcggcacccaggccgggaagaccacgatgctcaactgcctcggctcggcgatcccc
gcccgcgaacgggtgatcagctgcgaggaggtcttcgagctgcggctgcgcgcacccgac
tgggtcgccatgcagaccaggcaggcgaacctcgagggcaccggggagatccggctccgc
cgcctgatcaaggaggcgttgcggatgcgcccggaccggctgctcgtcggcgaggtccgc
caggaggaggccctggacctgctgatcgcgctgaactcgggcctgccggggatgtgcagc
ctgcacgccaactcggcgcgggaggccgtcaccaagctgtgcacactgccgctgctcgcc
ggcgagaacgtcagtcacaacttcgtcgtcccgaccgtcgccgcgagcgtggacctcgtc
gttcacctgatcaaggacgcgcacggccgccgacgggtgacggagatcgtcgcgctgccc
ggccgggccgagggcgacgtcgtcgaggtcgcgcagatcttccggtcctacggcgacacg
ctggtccgcgccgagggctatccgccgcacccggaccggttcgcccgggccggctacgac
ctcgccgcgctgctggccccgccggaccggggctggccggagatcgcggtggagcgatga

DBGET integrated database retrieval system