KEGG   Frankia sp. EuI1c: FraEuI1c_6036Help
Entry
FraEuI1c_6036     CDS       T01354                                 

Definition
(GenBank) hypothetical protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7424441..7425790)
Genome map
AA seq 449 aa AA seqDB search
MSLPILTAVTDAVVEAGLVSAFDRTDLGVTVVRRCVDLPDLLAAATTGAARAALLSADLR
RLDREALTRLALANVAVVGLIAPGDEDGDRRLRQLGVVAVITTDATADEVAGAVVEAAKA
LTGRPAIGPVSISRGYSDPIAGYGTRQPPLLGDPALGDAQARLDETDPAPFEAGRVVAVW
GPTGAPGRTTLALGLAAELADLGAATLLVDADSYGGSIGQLVGLLEEAPGLAAATRAANQ
GMLDVPRLAVLCRDLGGGLRVLPGIARPSRWPELRPSALENVLDLARRLAQFVIVDCGFC
LEADEELSYDSSAPRRNGATHAVLAAADTVIAVSSAEPVALVRFVRGLADLRELVPGVEP
LVVVNRLRASVAGGDPRREISRALNRHTGTEPIALVPYDLAAFDSAQAAGQLLRDIAPTS
PARVAIRDLASRLAGRVPRGQRRRLNARR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgccgatcctgaccgccgtcaccgacgccgtcgtcgaggccgggctggtctcg
gcgttcgaccgcaccgatctcggcgtcaccgtcgtgcgccgctgcgtcgacctgccggac
ctgctcgcggccgcgacgaccggcgcggcccgggcggcgctgctgtccgccgacctgcgc
cggctcgaccgagaggcgctgacccggctcgcgttggcgaacgtcgcggtcgtcgggctg
atcgcgccgggagacgaggacggtgaccgccggctgcgccagctcggggtcgtcgcggtg
atcacgacggacgccaccgccgacgaggtcgccggcgcggtcgtcgaggcggcgaaggcg
ctgacgggccggccggcgatcggcccggtctcgatcagccgcgggtacagcgatccgatc
gccggctacggcaccaggcagccgccgctgctcggcgaccccgcgctcggcgacgcgcag
gcccgcctcgacgagaccgacccggcccctttcgaagcgggccgggtcgtcgcggtctgg
ggtccgaccggcgcgcccgggcggacgaccctggcgctgggtctggccgccgagctcgcg
gacctcggcgccgccaccctgttggtcgacgccgactcctatggaggctcgatcggccag
ctcgtcggcctgttggaggaggcgccggggctcgccgccgccacccgtgccgccaaccag
gggatgctcgacgtgccgcggctggccgtgctgtgccgggacctgggcggcgggctgcgg
gtgctgccggggatcgcccggccgtcgcgctggcccgagctgcggccgagcgcgctggag
aacgtgctcgacctcgccaggcggctggcccagttcgtcatcgtcgactgcggcttctgc
ctggaggccgacgaggagctgagctacgacagctcggcgccccggcgcaacggcgcgacc
cacgccgtgctggccgcggccgacaccgtgatcgccgtcagctccgccgaaccggtcgcg
ctcgtgcgctttgtgcgcgggctcgccgacctgcgcgagctggtgccgggggtcgagccg
ctggtcgtcgtcaaccggctgcgtgcctcggtcgcgggcggcgatccgcgccgcgagatc
agccgggcgttgaaccggcacaccggcaccgagccgatcgcgctggtgccctacgacctg
gccgccttcgattccgcccaggccgccggccagctgctgcgcgacatcgccccgacctca
cccgcgcgggtggcgatccgtgacctggcgtcgcggctcgccggccgcgtcccacgcggc
cagcgccgccgcctcaacgcccgccgctga

DBGET integrated database retrieval system