KEGG   Frankia sp. EuI1c: FraEuI1c_6044Help
Entry
FraEuI1c_6044     CDS       T01354                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7435026..7435739)
Genome map
AA seq 237 aa AA seqDB search
MTVDEQRSPEAPRAPSEENPIRVLIVDDHALFRRGLEMVLAQEPDIEVVGEAADGSEAVT
MAGEMAPDIVLMDVRMPRRGGIDATSAIKEAVPSAKIVMLTISDEEADLYDAIKAGAMGY
LLKEISIDEVAADIRAVYNGQSLISPSMASKLLSEFASMIKNKDDRPQLPTPRLTDREME
VLRLVAKGLNNRDIAKQLFISENTVKNHIRNILEKLQLHSRMEAVVYAVREKLLEIT
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggacgagcagcgctcgcccgaggcgccgcgcgcgccatcggaggagaacccg
atccgagtgctgatcgtcgacgaccacgcgctgttccgccgcgggctcgagatggttctc
gcgcaggagccggacatcgaggtcgtcggggaggccgcggacggttcggaggcggtgacg
atggccggtgagatggcgccggacatcgttctgatggacgtgcggatgccgcggcgcggg
gggatcgacgcgacgagcgccatcaaggaggcggtcccgagcgcgaagatcgtcatgttg
acgatcagcgacgaggaggccgacctctacgacgccatcaaggccggcgcgatgggctac
ctgctcaaggagatctcgatcgacgaggtcgccgccgacatccgggcggtctacaacggc
cagagcctgatcagcccgtcgatggcgtccaagctgctcagcgagttcgcgtcgatgatc
aagaacaaggacgaccgcccccagctccccacgccacgcctgaccgaccgggagatggag
gtgctccggctcgtcgcgaaggggctgaacaaccgcgacatcgccaagcagcttttcatc
agcgagaacacggtcaagaaccacatccgcaacatcctggagaagctccagctgcactcc
cggatggaagccgtcgtctacgcggtccgcgagaagctgctcgaaatcacctga

DBGET integrated database retrieval system