KEGG   Frankia sp. EuI1c: FraEuI1c_6050Help
Entry
FraEuI1c_6050     CDS       T01354                                 

Definition
(GenBank) ATPase associated with various cellular activities AAA_3
  KO
K03924  
MoxR-like ATPase [EC:3.6.3.-]
Organism
fri  Frankia sp. EuI1c
Brite
Enzymes [BR:fri01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     FraEuI1c_6050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7441760..7442998
Genome map
AA seq 412 aa AA seqDB search
MTTPYPGAPVPGALPSSEDAGSETLRAPLSPVAPPVASHPTGPQAVAPAQWGPTPTPPVA
PPPPAAAPPPAYQAPAYYPPPPAAPAPPPGTPTAAEQEAARAALIRLRTEVGKAVIGQDA
AVSGLVVALLCRGHALLEGVPGVAKTLLVRTLARALTLDTKRLQFTPDLMPGDVTGSLFY
DTKTGEFGFRPGPVFTNLLLADEINRTPPKTQAALLEVMEERQVSIDGTPRPLPSPFAVL
ATQNPVEHEGTYPLPEAQLDRFLVKVTLPMPPRDDEIKVLAHHAAGFDPSDLDAAGVSAV
AGPTELAVARAGARAVQVRPEVLAYIVDVARATRSQPSVLLGVSPRGATALLATSKAWAW
LSGRGYATPDDVKALARATLRHRISLRPEAELDGVTGDRVLEQVLATVPVPR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgacaactccgtaccccggtgcccccgttcccggcgctctcccctcttccgaggacgcc
ggatcggagacgctgcgcgcgccgctcagcccggtcgcgccgcccgtcgcgtcgcacccg
accggtccgcaggccgtcgctcccgcgcagtggggaccgacgcccaccccgccggtcgcg
ccaccgccgcccgcggccgcgccaccgccggcctaccaggcccccgcgtactacccgcca
cccccggccgcgccggccccgccaccggggacgcccacggcggccgagcaggaggcggcg
cgggcggccctgatccggttgcgcaccgaggtcggcaaggccgtcatcggccaggacgcc
gcggtcagcggcctcgtcgtggcgctgctctgccgcggccacgcgctgctcgagggcgtc
cccggcgtcgccaagacactgctcgtgcgcaccctggcccgggcgctcacgctggacacg
aagcggctgcagttcacccccgacctcatgcccggcgacgtgaccggctcgctgttctac
gacaccaagaccggcgagttcgggttccgcccgggcccggtcttcacgaacctgctgctc
gcggacgagatcaaccggacgcccccgaagacccaggccgcgctgctggaggtcatggag
gagcggcaggtcagcatcgacggcaccccccgcccgctgcccagcccgttcgcggtgctg
gccacccagaaccccgtggagcacgagggcacctacccgctgcccgaggcccagctcgac
cggttcctggtgaaggtgacgctgccgatgccgccccgggacgacgagatcaaggtgctc
gcccaccacgcggccggcttcgacccgtccgatctggacgccgccggggtcagcgccgtc
gccgggccgaccgagctagcggtggcccgcgccggggccagggccgtgcaggtcaggccg
gaggtgctcgcctacatcgtcgacgtggcccgcgcgacgcgcagccagccgtcggtgctg
ctcggggtctcaccgcgtggcgcgacggcgctgctcgcgacctccaaggcctgggcctgg
ctgtccggccggggctacgcgaccccggacgacgtgaaggcactcgcccgcgcgaccctg
cggcaccggatcagcctgcgccccgaggctgagctcgacggcgtgaccggcgaccgggtg
ctcgagcaggtactcgcgaccgtgcccgtcccccgctga

DBGET integrated database retrieval system