KEGG   Frankia sp. EuI1c: FraEuI1c_6051Help
Entry
FraEuI1c_6051     CDS       T01354                                 

Definition
(GenBank) protein of unknown function DUF58
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7443005..7444333
Genome map
AA seq 442 aa AA seqDB search
MAITGRAVGCAFLGALAVALAPAPWLVLLGVNLLVVVLVAVDVALAGSVRPLELTRSGPR
GARLGQPVPLVLTVGNKGERTARLRIRDGWPPSAGARPAVHKVTVPAGERRFLESTLYPS
RRGDREPYRITIRSLGPLGLAGRQGRHHVPWRVRVLPPFHSRRHLPAALARLREVEGQVA
IRGGGAGSEFDSLRDYVIGDDVRAIDWRGTARRGAVVVRTFRPERDRRVICVLDTARTSA
GRVGALSPDGGPGLGGVPRLDHALDAALLLAAVALRAGDRVGLVAHDSEARLVLPDSAEA
NVLTRMSEAMATLEPALVETDHDGLVSTVLRTARRRSLVVIFTELVPAVVEESLLPALPA
LTSRHTVLVAALRDPRLAELAAGRGDVRAVYAAAAAEQTLLRRRQLTEELRGRGVEVVDA
GPAGYAPAVTDAYLTLKSLGRL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaccggacgggcggtcggctgcgcgttcctgggcgcgctggcggtcgcgctc
gcaccggctccctggctggtgctgctgggggtcaacctgctggtcgtcgtgctggtggcg
gtggatgtcgcgctggccggctcggtccggccactggagctgacccgcagcgggccgcgg
ggcgcgcggctcggccagccggttccgctggtgctgacggtcggcaacaagggcgagcgg
accgcgcggctgcggatccgggacggctggccgccgtcggccggcgcccgcccggccgtc
cacaaggtcaccgtgcccgccggtgagcggcggttcctggagtccacgctgtacccgagc
cggcggggcgaccgggagccgtaccggatcaccatccggtcgctcggcccgctggggctg
gccgggcggcaaggccgtcatcacgtgccgtggcgcgttcgggtgctgccgccgttccac
tcccggcggcacctgccggcggcgctggcgcggctgcgcgaggtcgagggccaggtggcg
atccggggcggcggcgccggctccgagttcgacagcctgcgcgactacgtgatcggcgac
gacgtccgcgcgatcgactggcgtggcaccgcccggcggggggccgtcgtcgtgcggacc
ttccggccggagcgggaccgccgggtgatctgcgtcctcgacacggcccgcacctcggcc
ggccgggtcggcgcgctgtcgccggacggcgggcccgggctgggcggcgtgccgaggctc
gaccacgcgctggacgccgcgctgctgctcgccgccgtcgcgttgcgggccggcgaccgg
gtcggcctggtcgcgcacgacagcgaggcccggctggtgctgcccgactcggccgaggcg
aacgtgctgacccggatgagcgaggccatggcgacgctggagccagcgctcgtcgagacc
gaccacgacggcctggtctcgaccgtgctgcgcacggcgcgtcggcgctccctggtagtg
atcttcaccgagctggtgccggcggtggtcgaggagtcgctgctgccggcgctgccggcg
ctgaccagccggcacaccgtcctggtcgccgcgctgcgcgacccacggctggccgagctc
gccgccggccgcggcgatgtccgcgcggtgtacgcggcggcggcggccgagcagaccctg
ctacggcgacgccagctcaccgaggaactgcgcgggcgcggcgtcgaggtcgtcgacgcc
ggcccggccggttacgcccccgccgtcaccgacgcctacctgacgctgaagtcgctcggc
cggctctga

DBGET integrated database retrieval system