KEGG   Frankia sp. EuI1c: FraEuI1c_6053Help
Entry
FraEuI1c_6053     CDS       T01354                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fri  Frankia sp. EuI1c
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FraEuI1c_6053
Enzymes [BR:fri01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FraEuI1c_6053
Exosome [BR:fri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FraEuI1c_6053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7444904..7447417
Genome map
AA seq 837 aa AA seqDB search
MSHKSDADRGRRMTQVVFEYRTGVTRRIATGALLTGSWDASGYPSTNWTSVPMTETTGPD
GAPAFRATVALDASIPFTCRWGVWLLGEDGSQFWGIPGEVADPTDTDQVRLLALDPAGPA
TVDATFSLTSHHFLGAVPDGTGGIVFRVWAPNAQSVEVAFGGPSGYLADDGYGEATTRAR
LPLSLGPDGIWTAGADGFADQVGGYYLYRVTREDGSVAWRTDPYSRQQSGGGDVNPDGAH
YDGDVAGLDGTVSCSVVVDASPAAAFGTGAADFWADELDPAHPLPRRVEDLVIYELHVGA
LGFGETAETDDPSGDPKAGTFADAVAFVDYLADLGVNAVELLPILEFSGSRSWGYGTSHF
LAVEKSAGGRAGLATFVRACHRRGIAVLVDLVFNHFTQDAERAEWMYDTTTPSRNSYYWY
EGSDADHAAFPDGGYVDNLSSGWAPRYREEQVRALFVAGAAALVEEFHVDGFRLDQTTSI
HLYNALHADGSPVGAANVAGRKFLRELCQTLRTMAPDIILIAEDHSGWDQVTEPAQTGGL
GFDARWYVDFYHHLIGDKDEGPEYARLLDTAGRDLDGPLAMGLFAGALAGSANRTVVYPE
SHDEAGNAEHSERNILIAVNNAPLVGETRWYAEARMRCVTALSLLTAGTPMFLMGDEVGA
QKAYTYNHFTENKEDLYGLRAGPGAGLFAAHRDLIGLRLGSPAAKSRNLEVLHTNDGGRV
IAFRRWSDPTDDDQAGGGPTGGGPTGGGPARATVEEMLVVCSLNNQPFPSYLLRHPALTG
APWRLRLSTDDPAYNGRADAPTTGNFVVTADGDGTLDLRLPAVATLVFTRLAGATPA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaatccgacgcggaccgtggccgccggatgacccaggtcgtcttcgaatac
cggaccggggtgacgcggcggatcgcgaccggcgcgctgctcaccggcagctgggacgcc
agcgggtacccgagcaccaactggacgtccgtaccgatgaccgagaccaccggcccggac
ggcgctcccgccttccgcgcgacggtggccctcgacgcgtccatacctttcacctgtcgc
tggggcgtatggctgctgggcgaagacgggtcgcagttctggggaatccccggtgaagtc
gcggacccgaccgacaccgaccaggtgcggctgctcgcgctcgatccggccgggccggcc
acggtcgacgcgacgttcagcctcaccagccaccatttcctcggcgccgttccggacggc
accggcggaatcgtgttccgggtctgggcgccgaacgcccagtcggtcgaggtcgcgttc
ggcgggccgagtggctacctcgcggacgacggctacggcgaggccacgacgcgggcccgg
ctcccgctgagcctgggcccggacggaatctggacggccggcgccgacggcttcgccgac
caggtgggcggctattacctctaccgggtcacccgcgaggacggctcggtcgcctggcgc
acggacccctactcgcgccagcagagcggcggcggggacgtcaacccggacggcgcccac
tacgacggcgacgtcgcgggcctggacggtaccgtcagctgctcggtggtcgtcgacgcg
agcccggcggcggcgttcgggacaggtgcggcggatttctgggccgacgagctcgacccg
gcccatccgctgccgcgccgcgtcgaggatctggtcatctacgagctgcacgtcggcgcg
ctcggcttcggcgaaaccgcggagacggacgacccgtcgggcgacccgaaggcgggcacg
ttcgcggacgcggtcgcgttcgtcgactatctcgccgacctgggcgtgaacgcggtggag
ctgctgccgatcctggagttctcgggatcgcggtcgtgggggtacggcacgtcgcatttc
ctcgccgtggagaagagcgccggcgggcgggccgggctggccacgttcgtccgcgcctgc
caccggcgcggtatcgccgtcctcgtcgacctggtcttcaaccacttcacccaggacgcc
gagcgggccgaatggatgtacgacacgacgacgcccagccgcaactcctactactggtat
gagggcagcgacgccgaccatgccgcgttcccggacggcggctacgtcgacaacctgtcc
tccggctgggcaccgcgctatcgcgaggagcaggtgcgcgcgctgttcgtcgcgggggcg
gccgcgctggtcgaggagttccacgtcgacggtttccggctggaccagacgacgtccatc
cacctgtacaacgcgctgcacgcggacggcagcccggtgggcgcggcgaacgtcgccggt
cgcaagttcctgcgcgagctgtgccagaccctgcggacgatggcgccggacatcatcctg
atcgcggaggaccattccggctgggaccaggtgaccgagcccgcgcagaccggtggcctc
ggtttcgacgcccgctggtacgtcgacttctaccaccacctgatcggcgacaaggacgag
ggacccgagtacgcccggctgctcgacaccgcgggcagggacctcgacggaccgctcgcg
atggggctgttcgccggcgcgctcgccggctcggcgaaccggaccgtggtctatccggaa
agccacgacgaggccggcaacgccgagcattccgagcgcaacatcctgatcgcggtgaac
aacgcgccgctggtcggcgagacccgttggtatgccgaggcgcgcatgcgctgcgtcacc
gcgctcagcctgctcacggccgggacgccgatgttcctgatgggcgacgaggtcggagcg
cagaaggcgtacacgtacaaccacttcaccgagaacaaggaggacctctacgggctgcgg
gccgggccaggcgccgggctgttcgcagcccaccgcgacctgatcggccttcgcctcggt
tctcccgccgcgaaaagccgcaacctggaggtcctgcacaccaacgacggcggccgggtg
atcgcgttccggcgctggtccgacccgaccgacgacgaccaggccggcggtggcccgact
ggcggtggcccgactggcggtggcccggccagggccacggtcgaggagatgctcgtcgtc
tgcagcctgaacaaccagccgttcccgagctacctgttgcggcatccggcactgaccggc
gcgccgtggcgcctgcggctcagtacggacgatccggcctacaacggtcgcgcggacgcc
ccaaccaccgggaacttcgtcgtcaccgcggacggcgacggcaccctggacctgcggctt
cccgccgtcgccacgctcgtcttcacccgattggcgggggccacacccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system