KEGG   Frankia sp. EuI1c: FraEuI1c_6057Help
Entry
FraEuI1c_6057     CDS       T01354                                 

Definition
(GenBank) regulatory protein MerR
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7451042..7451632
Genome map
AA seq 196 aa AA seqDB search
MPTKAPRATLRLVIARRPGPATAGNPANGTGQSSADGRDLSGRAATWLPTARRAYAEAQV
REERFVREVLERLRAKVRLRPEQRLPIARAAAVLETTPRMLRYRESLGLVAPARSAGGHR
EYGERELVAAAYADELERRYQISPSDLAFAVRVLAEPAVAADVRRLGELTRRIAPHPPVA
ALDFEAQKARRLLDLP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaccaaggcaccccgggctacgcttcgcctcgtgatcgctcgcagaccgggcccc
gcgaccgccggcaaccccgccaacggcaccggccagagcagcgccgacggtcgcgacctc
tccggccgggccgccacctggctgccgaccgcgcggcgcgcgtacgccgaggcccaggtg
cgggaggaacggttcgtgcgcgaggtgctggagcggctgcgggcgaaggtccggctgcgc
ccggagcagcggctgccgatcgcgcgggccgccgccgtcctggagacgacgccgcggatg
ctgcgctaccgggagtcgctcgggctggtggcgccggcccgctcggccggtggccatcgg
gagtacggcgagcgcgagctggtcgcggccgcgtacgcggacgagctggagcgccgctac
cagatcagcccgagcgacctggccttcgcggtacgggtgctcgccgagccggcggtcgcc
gccgacgtgcgccggctgggtgagctgacccgccggatcgccccgcaccccccggtcgcc
gccctggacttcgaggcgcagaaggcccgacgcctcctcgacctgccctga

DBGET integrated database retrieval system