KEGG   Frankia sp. EuI1c: FraEuI1c_6058Help
Entry
FraEuI1c_6058     CDS       T01354                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7452052..7454388
Genome map
AA seq 778 aa AA seqDB search
MLDLPLAPASTPPPSSPVRAFGGRAAIISLAIALVVALLALPLVSGLGLFAKASADHYLD
LPSVLATPPLPQNSQILASNGTVVATLHGAENRVVVEGNQIPTVMRQAIVAIEDARFYEH
GGFDPKGVLRAALRNSQAGDVQQGGSTLTQQYVKNVLLQNATTPAERKAATDPSVGRKIQ
ELRYASALEKILPKDEILTRYLNIAYFGDGAYGVGTAAEHYFNVNVKDLTLGQAALLAGL
VQSPSRYDPTTNKAAATTRRNEVLDHMVTSKYISATQATGAKQLPITLNTTEGTTLDSCS
NSIAPFFCDYVRTELSSDPALGSTKEERQRRLYEGGLQIHTTLDMKAQEAAQNAVDTTIG
RDSRAVAPIVVVQPGTGNILAMAENRNFGADTSQNQTKINLPAFAPSTGGFEPGSAFKAF
TMATALEQGYGLSTGFYSPSCLNADTWPEIKSIFPITTDDKKCPDGYSNSADSESGAFDM
RDGTWQSVNTYYIQLEAKVGVTNVWAMARRLGIPQSDAPTDANGKVELGPTFGGLTLSQN
TQIAPLDMASAYAVFASGGKYCTPRFVTSATDSSKENVDIAPKPECKQAISEGIADTVAS
VLAGVITNGTGSPNANIGRPAAGKTGTNDNYSSAWFVGFTPQMAAAVALGDPRGSKYNLA
GLKADGKTWPEVFGGGLPALIFSRTLKPALQGTPVEPLPKADPTVAQGTKGGFQTDGAAA
PPPSPGVLIDPLTGQPITAPSGQPGTVTVTPLTPGQGGDTTGPRLPGQGDGNGNGNGH
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacctcccgctcgcgccggcttcgacgccgcccccgagcagccccgtgcgcgcg
ttcggtggccgggccgcgatcatctcgctggccatcgcgctggtggtggcgctgctcgcc
ctgccactcgtctccgggctgggcctgttcgccaaggcgtccgccgaccactacctggac
ctgccctcggtactggcgaccccaccactgccgcagaactcgcagatcctcgcctccaac
ggcaccgtcgtcgccacgctgcacggcgccgagaaccgcgtcgtcgtggaggggaaccag
atccccacggtgatgcgccaggcgatcgtcgcgatcgaggacgcccggttctacgagcac
ggcggcttcgacccgaagggcgtcctgcgcgccgccctgcgtaacagccaggccggcgac
gtccagcagggcggttcgaccctgacccagcagtacgtgaagaacgtgctgctgcagaac
gcgaccaccccggccgaacggaaggccgcgacggacccgtcggtcggccgcaagatccag
gagctgcgctacgcgtcggccctcgagaagatcctccccaaggacgagattctcacccgc
tacctcaacatcgcctacttcggcgacggcgcctacggtgtcggcaccgcggcggagcac
tacttcaacgtgaacgtgaaggacctgaccctgggccaggccgcgctgctcgccggtctg
gtgcagagcccgtcgcgctacgacccgaccaccaacaaggcggcggccaccacgcggcgc
aacgaggtcctcgaccacatggtgacgtcgaagtacatctcggcgacccaggccaccggg
gccaagcagctgccgatcacgctgaacaccacggaaggcaccacgctcgactcctgcagc
aattccatcgcgcccttcttctgtgactacgtccgaaccgagctgtccagcgacccggcg
ctcggttccaccaaggaagagcggcagcggaggctgtacgagggtggcctgcagatccac
acgaccctcgacatgaaggcgcaggaggcggcgcagaacgccgtcgacacgacgatcggg
cgggacagccgggccgtcgcgcccatcgtggtcgtccaacccggcaccggaaacatcctg
gcgatggccgagaaccggaacttcggcgccgacaccagccagaaccagaccaagatcaac
cttcccgccttcgcgcccagtaccggagggttcgagcctggctcggccttcaaggcgttc
accatggccacggcgctcgagcagggctacggcctgtccacgggtttctactcgccgagc
tgcctgaacgccgacacgtggcctgagatcaagagcatctttcccatcacgacggacgac
aagaagtgcccggacggctattccaactccgcggactcggagtccggcgccttcgacatg
cgggacggcacctggcagtcggtcaacacgtactacatccagctcgaggccaaggtcggc
gtgacgaatgtctgggccatggcgcgacgcctcgggatcccgcagagcgacgcgccgacg
gacgccaatgggaaggtggaactcggcccgaccttcggtggactgacgctcagccagaac
acgcagatcgcgccgctcgacatggccagcgcctacgcggtcttcgcctccggtgggaag
tactgcacaccgcggttcgtgacctcggcgaccgactcctccaaggagaacgtcgacatc
gcgccgaagcccgagtgcaagcaggccatctccgaggggatcgcggacacggtcgcgagc
gtgctggccggagtcatcaccaacggcaccggttccccgaacgcgaacatcgggcgcccc
gccgccggcaagaccgggaccaacgacaactactccagtgcctggttcgtcggcttcacc
ccgcagatggccgccgcggtcgcgctcggcgacccccgtggctcgaagtacaacctcgcc
ggcctcaaggcggacgggaagacctggcctgaggtcttcggcggcggtctgccggctctg
atcttcagccggacgttgaagccggcgctacagggcacaccggtggagccgttgcccaag
gccgacccgacggtcgctcagggcacgaagggcggcttccagaccgacggcgcggcggcg
ccgccgccgtcccctggcgtgctgatcgacccgctgaccggccagccgattaccgccccg
tcaggccagccaggcacggtcaccgtcaccccgctgacacctggccaggggggcgacacc
acgggcccgcgcctcccaggccagggcgacggaaatggcaacggcaacggccactag

DBGET integrated database retrieval system