KEGG   Frankia sp. EuI1c: FraEuI1c_6060Help
Entry
FraEuI1c_6060     CDS       T01354                                 

Definition
(GenBank) protein of unknown function DUF343
  KO
K09791  
uncharacterized protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7455803..7456006)
Genome map
AA seq 67 aa AA seqDB search
MSLDPLLLEILACPCPQHAPLRQDTLAGAPVLVCTACNLAFPVRDDIPVMLLDEASPFPE
AAAPATS
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgatccgctgcttttggagatcctcgcctgcccgtgtccgcagcacgccccg
ctgcgtcaggacacgctggccggcgccccggtcctcgtctgcaccgcctgcaacctggcg
ttcccggtgcgcgacgacattccggtgatgctgctcgacgaagcgagtccgttcccggag
gccgccgccccggcgacgtcctga

DBGET integrated database retrieval system