KEGG   Frankia sp. EuI1c: FraEuI1c_6061Help
Entry
FraEuI1c_6061     CDS       T01354                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
fri  Frankia sp. EuI1c
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FraEuI1c_6061
   00520 Amino sugar and nucleotide sugar metabolism
    FraEuI1c_6061
Enzymes [BR:fri01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     FraEuI1c_6061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7456015..7457373)
Genome map
AA seq 452 aa AA seqDB search
MGLDLARIFKAYDVRGVVPSEFDADIARATGAAFVRLLDAKEIVIAHDMRESSGPLSAAF
AEGATSQGADVVLAGLGSTDLLYFAAGSLNLPGAMFTASHNPAKYNGIKMCRAGAAPIGQ
ETGLAEIRDMVATGVPAYTGTPGSVREVDLLEAYVAHLRTLVDLSGIRPLKVVVDAGNGM
GGYTVPAALAGLPLDVVPLYFELDGSFPNHEANPIEPENLRDLQKAVRDSGADIGLAFDG
DADRCFVVDERGELVTPSTITALVAERELAREPGGTIIHNVIVSKAVPELVRKLGAVPVR
TRVGHSFIKGEMARTGAIFGGEHSGHFYFRDFWRADSGMLAALHVLAALGGQAGPLSALL
DGYAPYAVSGEINSEVADAAASMKAIEAEYAHKATDIDHLDGLTISLADGSWFNLRPSNT
EPLLRLNVEAGDDDTMSRLRDEVLASIRGGRD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggggcttgacctcgcccggatcttcaaggcgtatgacgtgcgcggggtcgtgccgtcc
gagttcgacgcggacatcgctcgcgccaccggcgcggcgttcgtccggctgttggacgcc
aaggagatcgtgatcgcgcacgacatgcgcgagtcgtccggtccgctgtccgcggcgttc
gccgagggcgccacgagccagggcgccgacgtcgtgctcgccgggctcgggtcgacggac
ctgctgtacttcgccgccggctcgctgaacctgccgggcgcgatgttcaccgcgtcgcac
aacccggccaagtacaacggcatcaagatgtgccgcgccggcgccgcgcccatcgggcag
gagaccggtctggccgagatccgcgacatggtcgcgaccggggtccccgcgtacaccgga
acgcccggctcggtccgcgaggtggacctgctggaggcctacgtcgcccacctgcgcacg
ctggtcgacctgtccggcatccggccgctgaaggtcgtggtcgacgccggcaacggcatg
ggcggctacaccgtgccggcggccctcgccggcctgccgctcgacgtcgtcccgctctac
ttcgagctggacggcagcttcccgaaccacgaggcgaacccgatcgagccggagaacctg
cgcgacctgcagaaggccgtccgcgacagcggcgccgacatcggcctcgccttcgacggc
gacgccgaccgctgcttcgtcgtcgacgagcgcggcgagctggtcaccccatccaccatc
accgcgctggtcgcggagcgggagctcgcccgcgagcctggcgggaccatcatccacaac
gtgatcgtcagcaaggcggtcccggagctggtccgcaagctcggcgccgtcccggtgcgc
acccgcgtcgggcactcgttcatcaagggtgagatggcccggacgggcgccatcttcggc
ggcgagcactcgggccacttctacttccgggacttctggcgggccgactcggggatgctc
gcggccctgcacgtcctcgccgcgctcggcggccaggccggcccgctctcggccctgctc
gacggctacgctccgtacgccgtgtccggggagatcaactcggaggtcgccgacgcggcc
gcgtcgatgaaggccatcgaggccgagtacgcgcacaaggccaccgatatcgaccacctg
gacggcctgaccatctcgctcgcggacggctcgtggttcaacctgcggccgtccaacacc
gaaccgctgctgcgcctcaacgtcgaggcgggggatgatgacaccatgagccggctgagg
gacgaggtcctggccagcatccgtggtggaagggactga

DBGET integrated database retrieval system