KEGG   Frankia sp. EuI1c: FraEuI1c_6067Help
Entry
FraEuI1c_6067     CDS       T01354                                 

Definition
(GenBank) transcription factor WhiB
  KO
K18955  
WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
fri  Frankia sp. EuI1c
Brite
Transcription factors [BR:fri03000]
 Prokaryotic Type
  Other transcription factors
   Others
    FraEuI1c_6067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7465599..7466396)
Genome map
AA seq 265 aa AA seqDB search
MEHTDAGVRTPPVGLRTREEDEHDRTAVGRPATALGPRPGVLGVTRPPTPRAPVDAHATA
ELRVPTPTSYAGRVTPDAGYDLVRPVPGSAQPLGYATTRRVEAVAVLDDADARAEDTRVE
DVTAQDTATEADELDSDDDTEDDADDVDDELDDDELDAELPGPGQPGGVPAGGASRPMLA
EVIDIGLGDLLGEVMEWQERALCAQTDPEAFFPEKGGSTREAKRICSGCEVRTECLEYAL
ANDERFGIWGGMSERERRKQRRRAV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggagcacaccgacgcgggcgtccgaacgccgccagtgggcctacggacgcgcgaggag
gacgagcacgaccgcacggctgtgggccgcccggccacggcgctgggcccgcggcccggc
gtcctgggcgtgacccgcccgcccacgccccgggcgcccgtggacgcgcacgcgaccgcg
gagctgcgggtgccgacccccacgtcctacgccggacgggtcacgcccgacgccggctac
gacctcgtccgcccggtgcccggctccgcgcagccgctcggctacgccaccacccgccgc
gtcgaggccgtcgcggtccttgacgacgccgacgcgcgggccgaggacacgagggtcgag
gacgtgacggcgcaggacacggccaccgaggccgacgagctcgacagtgacgacgacacc
gaggacgacgcggacgacgtcgacgacgagctcgacgacgacgagctcgacgcggagctt
cccgggcccggccagccgggcggcgtcccggccggcggcgcgagccggccgatgctcgcc
gaagtgatcgacatcgggctgggtgacctgctcggcgaggtcatggagtggcaggagcgc
gccctgtgcgcgcagaccgacccggaggccttcttcccggagaagggcggctcgacccgg
gaggccaagcgcatctgctcgggctgcgaggtccgtaccgagtgcctcgagtacgcgctc
gccaacgacgagcggttcggtatctggggcgggatgtccgaacgcgaacggcgcaagcag
cgccgccgggccgtatag

DBGET integrated database retrieval system