KEGG   Frankia sp. EuI1c: FraEuI1c_6072Help
Entry
FraEuI1c_6072     CDS       T01354                                 

Definition
F420 biosynthesis protein FbiB, C-terminal domain-containing protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
fri  Frankia sp. EuI1c
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:fri00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7472934..7474307
Genome map
AA seq 457 aa AA seqDB search
MSEPGHDVTGPGRAAAVDPVRDGLQIYPVPGLGEIRPGDDLAAAIATALGAAGLGLRDGD
VLVVTSKIVSKAEGRIVRVTGDREAARLDAIEAETVRDVASRGPTRIVETRHGFVLAAAG
VDASNIAKDSLALLPLDSDESARRLRAGLAQRCGGVDVAVVVSDTAGRPWRRGVVDQAIG
LAGMAALRSHIGDVDGYGNELGMTEVAEADQLAAAAELVKGKLTATPVALVRGFAVVADD
GRGVRSIVRPPAEDMFRLGTLEARRAALTERRTVRAFSDAAVDPAAIERAVAAAVTAPAP
HHTTPWRFVVVAERRAELLAAMTAAWTRDLRRDGFPEDAIARRLRRGDVLANAPVLVVPL
VTDDGAHAYPDARRAGAEERMFTVAGGAGVQNFLVALATEGLGSAWVSSTLFCADVVRAV
LDLPAGWAPLGAVAVGHPAAPAPARPPRDPGAFILHR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagcctggccacgacgtcaccggcccgggccgggccgcggcggtcgacccggtg
cgcgacgggctgcagatctacccggttcccgggctcggcgagatccggcccggcgacgac
ctggcggccgcgatcgccacggcgctgggcgccgcggggctgggtctgcgggacggcgac
gtcctggtcgtcacctcgaagatcgtttcgaaggccgaggggcggatcgtgcgcgtcacc
ggcgaccgggaggccgccaggctcgacgcgatcgaggcggagaccgtccgcgacgtcgcc
agccgtggcccgacccggatcgtcgagacccgccacggcttcgtgctcgcggcggccggc
gtcgacgcgtcgaacatcgccaaggacagcctggcgctgctcccgctggactccgacgaa
tccgcccgccggctgcgggccgggctcgcccagcgctgcggcggggtcgacgtcgcggtc
gtcgtgtccgacaccgctggccggccctggcggcgcggcgtcgtcgaccaggcgatcggc
ctcgccgggatggccgcgctgcgcagccacatcggtgacgtcgacggctacggcaacgag
ctggggatgaccgaggtcgccgaggcggaccagctggcggccgcggccgagctggtgaag
ggcaagctcaccgccaccccggtcgccctcgtccgcggtttcgccgtggtggccgacgac
gggcgcggggtgcgctccatcgtccgcccgccggccgaggacatgttccgcctcgggact
ctggaggcccggcgggcggcgctcaccgagcggcggaccgtccgggcgttcagcgacgcc
gccgtcgacccggcggcgatcgagcgggcggtcgccgcggcggtgaccgcgcccgcgccg
caccacaccaccccgtggcggttcgtggtcgtcgccgagcggcgcgccgagctgctggcc
gcgatgacggccgcgtggacgcgggacctgcgccgcgacggcttccccgaggacgcgatc
gcgcgacggctgcgccgcggcgacgtgttggcgaacgcgccggtgctggtcgtcccgctg
gtcaccgacgacggcgcgcacgcctacccggacgcgcggcgagccggggccgaggagcgg
atgttcaccgtcgcgggcggcgccggggtgcagaacttcctggtggcgctggcgaccgag
ggcctcggctcggcctgggtgtcgagcaccctgttctgcgccgacgtcgtccgtgcggtg
ctggatctgccggccggctgggcgccgctgggcgccgtcgcggtaggccacccggccgct
ccggcgccggcgcggccaccgcgggatcccggcgcgttcatcctgcaccgctga

DBGET integrated database retrieval system