KEGG   Frankia sp. EuI1c: FraEuI1c_6081Help
Entry
FraEuI1c_6081     CDS       T01354                                 

Definition
(GenBank) Methyltransferase type 11
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7482299..7483426)
Genome map
AA seq 375 aa AA seqDB search
MRFVLSPIVKASTRSAAAGRARTRRTRTRTGAWVSRGRDPREPDGRDAPEAKERDARASH
GRDARGSRGRDARGSRGRDARGSRGRDAPRRGRQLAYSELEPRSLDEFTRRRKARKLIAV
LAHFLGRDGEGAQALAGLRVLDIGCSAGFICDELAAAGAEVTGVDIDSAGLRRARARFAR
RARFIQADGLALPLADGTVDVVVLNHIYEHVVDADVLLAEVRRVLARDGLAYLGLGNRLG
IMEPHHGLPLLSWLPPGLADRYLRAAGRGEHYYERYRSRPGLRRMLARAGLRAWDYTVPV
LLAPEAFHAEADLPPGGPARGLLRAVTAPGRLPAPARAWLARAALPLAPTYLWVATPGSR
GPAGHTLPGGPQPVT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcgtactctcaccgattgtgaaagcatcaacacgtagtgcggcggcggggcgg
gcgcgaacccgtcgaaccaggacacggacgggcgcctgggtctcgcgcgggcgcgacccg
cgagagccggacgggcgggacgcgcccgaggcgaaggagcgggacgcacgggcgtcccac
ggccgggacgcgcggggctcccgcgggcgggacgcgcggggctcccgcgggcgggacgcg
cggggctcccgcgggcgggacgccccgaggcgcgggcgccagctggcctactccgagctg
gagccgcggtcgctggacgagttcacccggcggcgcaaggcccgcaagctgatcgccgtg
ctcgcccacttcctcgggcgcgacggcgagggggcgcaggcgttggccgggctgcgggtg
ctcgacatcggctgctccgccgggttcatctgcgacgagctcgccgcggccggcgccgag
gtgaccggcgtcgacatcgactcggccgggctgcgccgcgcccgggcccggttcgcccgc
cgggccagattcatccaggccgacggcctggcgctgccgctggccgacggcaccgtggac
gtcgtcgtgctgaaccacatctacgagcacgtcgtcgacgcggacgtgctgctcgccgag
gtgcgccgggtgctcgcccgggacgggctcgcctacctcggcctgggcaaccgcctcggg
atcatggagccgcaccacgggctgccgctgctgtcctggctgccgcccggcctggccgac
cgctacctgcgggcggccggccgcggtgagcactactacgagcgctaccggtcccggccg
ggcctgcgccggatgctggcccgagccggcctgcgggcctgggactacacggtgccggtg
ctgctcgctcccgaggcgttccacgccgaggccgacctgccgccgggcgggccggcccgt
ggcctcctgcgcgcggtgaccgcgccagggcggctgccggcgccggccagggcctggctg
gcccgcgccgccctgccgctggctccgacctacctgtgggtcgccacgccgggctcccgg
ggtcccgccggccataccctgcccggcggtccccagccggtcacgtga

DBGET integrated database retrieval system