KEGG   Frankia sp. EuI1c: FraEuI1c_6084Help
Entry
FraEuI1c_6084     CDS       T01354                                 

Definition
(GenBank) putative acetyltransferase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7485930..7486700
Genome map
AA seq 256 aa AA seqDB search
MALPTSRARDGPGGQITGPGEPGPHPGAYCGNVGAFRSDLREYVQHVRSLHAGRETSAVA
FVTGLRYPLAYGKPIWTGSRTIIEGHERFEFRADGVLRVGLGSFGLSSKHDTSVVRVHPE
GRLRCEGVVSMQRGVRVVVDSGLLQIGHGTNINGFAKILVRDRVSIGEHCTISWNTQLLD
NDFHPIVVDGVPQPQSAPIVIEDHVWIGAGAIVLKGVTIGEGAIVAAGAVVTKDVPAKTI
VAGSPAKSIGTADAWS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgcccacgtcgcgggcacgcgacgggcccggcggccagatcaccggccccggt
gagccagggccgcatcccggcgcctactgtggaaacgtgggtgcgttcaggagtgatcta
cgcgagtacgtccagcacgtccggtccctgcacgcgggccgcgagacctcggcggtcgcg
ttcgtcaccgggctgcgctacccgttggcctacgggaagccgatctggaccggttcgcga
accatcatcgagggccacgagcggttcgagttccgcgccgacggggtgctgcgggtgggc
ctcgggtcgttcggcctgtccagcaagcacgacacctcggtggtgcgggtgcaccccgag
ggccggctgcgctgcgagggcgtcgtgtcgatgcagcgcggggtgcgggtcgtcgtggac
tccggcctgctgcagatcgggcacggcacgaacatcaacggcttcgcgaagatcctggtc
cgggaccgggtgtcgatcggcgagcactgcacgatctcgtggaacacccagctcctggac
aacgacttccacccgatcgtggtcgacggggtgccgcagccgcagagcgcgccgatcgtc
atcgaggaccatgtctggatcggcgccggcgcgatcgtgctgaagggcgtcacgatcggc
gagggcgccatcgtcgccgccggcgcggtcgtgaccaaggacgtcccggccaagaccatc
gtcgccggatcacccgcgaagagcatcggcaccgccgacgcctggagctga

DBGET integrated database retrieval system