KEGG   Frankia sp. EuI1c: FraEuI1c_6086Help
Entry
FraEuI1c_6086     CDS       T01354                                 

Definition
(GenBank) serine/threonine protein kinase with WD40 repeats
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 Pkinase Ge1_WD40 Pkinase_Tyr ANAPC4_WD40 eIF2A APH Glyoxal_oxid_N Cytochrom_D1 RIO1
Motif
Other DBs
NCBI-ProteinID: ADP84070
UniProt: E3J106
Position
7489477..7492371
Genome map
AA seq 964 aa AA seqDB search
MRRNQRQALAVPAARPQPSASTGAATGGNTVADQAAAENTAASAVADVAATTTASAVADV
PATTAKAGVAEAEPPLAPPPLAPPALAPPAEPGAPLPAAPSEAAAHLSTAQTLLGLAAPR
RAPVVAQQAPTLPQQLTLPTHPTYPLGAVAAEPLAPDDPEQLGDYQLVGRLGEGGMGTVY
LGVAGADTAIGPHGLDGELRLVAIKMIRADLARLPEFRARFLREADVARRVSRFCTAEVL
EVVDPPNGPPYLVTEYIDGLTLTRAVLAGGPLRTGDLERLAVSVAAALTAIHGAGLVHRD
LKPSNVILSALGPRVIDFGIAQATDAHGVLSHDIQRIGTPAFMAPEQANGQPVTAAADIF
AWGGLMTYAGTGVLPFGDGPTPVQLYRVVHTEPNLDGLGPALRPIVTHAMRKDPADRPTA
QELFLQLVGMGPQTHLDPAVSHAIRSGALPGPPTALVDTDPQPRLDLGHAADAAANASPA
AATATTGTTGTAPGTTNGQAAHLAATLRALIRPRVDEQAASPDPAPDASAIRTWRDGLRH
VSLLVTPLLALLLIGILIPVVLLHGPTKSPTPASVATDVAASADQVRPTDAALADALSLA
AFRISPALAARAGLRTSFAAAAATPLTGHTGAVLGAAVSPDGRVAATASADGSIRLWDVR
DAESSRPLAVIDQQDGWVTAAAFSPDGNLLATAGYNRLATLWDVSDPTRPSKVASLRGHD
GYVASVAFSPDGNLLATAGYDDTARVWNVVDPTDPVQLAVLTGHTGWVRQVAFSPDGRLL
ATASTDHTTRLWDVAVPTSPTLLATLTGHTDYVWALAFSPDGRELATAGYDGTARLWDVT
DPAHPRAVATIPADAHWVLAVAFSPDGRTLATGGRDGTVHLWDLTAPGQPAAAGVLAGHS
DWIESIAFTPDGRALLTGSADRTARLTPLSDDALTAAACRDRSSQLDSSQWQHYVPEVPY
RPTC
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcaaccagcgccaggcgctcgccgtcccggcggcacgcccgcagccgtcggcc
agcacgggcgccgcgacaggcgggaacacggtggcggatcaggccgcggccgagaacacg
gcggcatcggccgtcgccgacgtcgcggcgaccaccacggcgtcggccgtagccgacgtc
ccggcgaccacggcgaaggccggcgtcgcggaggccgagccgcccctcgctcccccgccc
ctcgctcccccggcgctcgctcccccggccgagccaggcgcaccgctgccggccgcgccg
agcgaggccgccgcgcacctgtcgaccgcgcagaccctcctcgggctcgccgcgccgcgc
cgcgcgcccgtcgtcgcccagcaggcaccgaccctgccccagcagctcacccttccgacg
catccgacgtatccgctgggagccgtcgccgccgagccactggccccggacgatccggag
cagcttggcgactaccagctggtcggccggctcggcgaaggcgggatgggcaccgtctac
ctgggcgtcgcgggggcggacacggccatcgggccacacggcctcgacggcgagctacgg
ctggtcgcgatcaagatgatccgggccgacctggcgcggctgcccgagttccgggcccgg
ttcctgcgcgaggcggacgtcgcccggcgggtgtcccggttctgcaccgccgaggtgctg
gaggtcgtcgacccgccgaacggcccgccctacctggtaacggagtacatcgacggcctg
acgttgacccgggccgtgctggcgggcggcccgctgcgcaccggcgacctggagcggctg
gcggtcagcgtcgccgccgcgctgaccgcgatccacggagccgggctcgtccaccgcgat
ctcaaaccgtcgaacgtgatcctctccgcgctcggcccgcgggtcatcgacttcggcatc
gctcaggcgaccgatgcgcacggggtgctcagccacgacatccagcgcatcggcaccccg
gcgttcatggcgcccgaacaggccaacggccagccggtgaccgcggcggcggacatcttc
gcctggggcgggctgatgacctacgcgggcacgggcgtcctgccgttcggcgacgggccg
acgccggtgcagctgtaccgcgtcgtccacaccgaaccgaacctggacggcctcggcccg
gcgctgcgcccgatcgtcacgcacgcgatgcgcaaggacccggccgaccggcccaccgcc
caggaactgttcctccaactcgtcggcatgggcccgcagacccacctcgacccggcggtc
agtcacgcgatccgctcgggtgccctgcccggaccccccacggcgctggtggacaccgac
ccgcagccgcgcctcgacctcgggcacgccgcagacgccgccgccaacgccagcccggcg
gccgcgaccgccacgaccggcacgaccggtacggcgcctgggaccaccaacggccaggcc
gcgcacctcgcggccaccctgcgggccctcatccgcccgcgggtcgacgagcaggcggcc
tcgcccgaccccgcgcccgacgccagcgcgatacgcacctggcgggacgggctgcggcac
gtctcactgctggtcacaccgctgctggcgctgctgctgatcgggatcctgatcccggtg
gtcctgctgcacggccccacgaagagcccgactccggcctcggtcgcgacggacgtcgcg
gcctcggccgaccaggtccgcccgaccgacgccgcgctcgccgacgcactgagcctcgcc
gcgttccggatcagcccggccctggccgcccgcgcgggcctgcgcacctcgttcgccgcc
gcggccgcgacaccgctcaccgggcacacaggcgccgtcctcggggccgcggtcagcccc
gacggccgggtcgccgcgacggcctcggccgacggcagcatccgcctctgggacgtccgg
gacgccgagtcctctcgcccgctcgcggtgatcgaccagcaggacggctgggtcaccgcc
gccgcgttcagcccggacgggaacctgctggccaccgccggctacaaccggctcgcgacg
ctgtgggacgtcagcgaccccacccggcccagcaaggtcgccagcctgcgcggccacgac
ggctatgtcgcctcggtggcgttcagcccggacgggaacctgctggccaccgccggctac
gacgacaccgcgcgggtctggaacgtcgtcgaccccaccgatccggtccagctcgccgtg
ctcaccggccacaccggctgggtcaggcaggtggcgttcagcccggacggccggctgctc
gccaccgcgagcaccgaccacaccacccggctctgggacgtcgccgtcccgaccagcccg
acgctcctggccaccctgaccggccacaccgactacgtctgggcactcgcgttcagcccc
gacggccgcgagctcgccaccgccggctacgacggcacggcgcggctctgggacgtcacc
gacccggctcacccgcgggccgtcgccaccatcccggccgacgcgcactgggtgctcgcg
gtcgccttcagccccgacggccggaccctcgccaccggcggccgcgacggcacggtccac
ctctgggacctcacggccccgggtcagcccgcggcggccggcgtgctggccggccactcc
gactggatcgagtcgatcgcgttcacccctgacggccgggcgctgctcaccggttccgcc
gatcgcacggcccggctgaccccgctgtccgacgacgcgctgaccgccgccgcgtgccgc
gaccgttccagccagctcgactcgtcccagtggcagcactacgtccccgaggtcccgtat
cggcccacctgctga

DBGET integrated database retrieval system