KEGG   Frankia sp. EuI1c: FraEuI1c_6309Help
Entry
FraEuI1c_6309     CDS       T01354                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fri  Frankia sp. EuI1c
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_6309
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FraEuI1c_6309
Exosome [BR:fri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FraEuI1c_6309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7764454..7765476)
Genome map
AA seq 340 aa AA seqDB search
MTTGGRPAGGPAAGFPLARPRRLRRTPALRRLVSDVRLHPADLILPAFVKEGVSEPVPVS
SMPGVVQHTRDSLRKAAAEAAEAGVGGIILFGVPAEKDARGSAADDPDGIVQLAIADLVS
EVGGSMVVMADLCLDEYTDHGHCGLLTETGDVDNDATLERYASIAVAQARAGVEVVAPSG
MMDGQVGAIRAALDGAGYPDLPILAYSAKYASAFYGPFREAAECAPQFGDRAGYQQDPAR
SAAEALREVALDLAEGADAVMVKPALAYLDVLRAVADAVDVPVAAYQVSGEYAMVEAAAA
NGWVDRDRIINETLTAIHRAGADLILTYWATEVAQKLRRA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgggggccggccggcgggcggtccggccgcgggcttcccgctggcccggccg
cgccggctgcgccgcacgccggcgctgcgccggctggtctccgacgtgcggctgcatccg
gcggacctgatcctcccggccttcgtcaaggagggcgtcagcgagccggtccccgtcagt
tcgatgcccggcgtcgtccagcacaccagggactcgctgcgcaaggcggccgccgaggcc
gccgaggcgggcgtcggcgggatcatcctgttcggcgtgccggcggagaaggacgctcgt
ggctcggcagccgacgacccggacgggatcgtgcagctggcgatcgcggacctcgtgtcc
gaggtcggcgggtcgatggtcgtgatggccgacctctgcctggacgagtacaccgaccac
ggccactgcggcctgctcaccgagaccggcgacgtcgacaacgacgcgacgctggagcgg
tacgcctcgatcgcggtggcgcaggcgcgtgccggcgtcgaggtggtcgcgccgagcggg
atgatggacggccaggtcggcgcgatccgggcggcgctggacggcgccgggtacccggac
ctgccgatcctggcctactcggccaagtacgcgtccgccttctacggcccgttccgggag
gccgccgagtgcgcgccgcagttcggcgaccgggccggctaccagcaggacccggcccgc
tcggccgccgaggcattgcgcgaggtcgccctcgacctggccgagggcgcggacgccgtg
atggtcaagccggcgctcgcgtacctggacgtcctgcgggccgtcgccgacgccgtggac
gtgccggtcgcggcctaccaggtctccggtgagtacgcgatggtcgaggccgccgcggcc
aacggctgggtcgaccgggaccggatcatcaacgagacgctgaccgcgattcaccgggcc
ggcgccgacctgatcctcacctactgggccaccgaggtcgcgcagaagctgcgccgcgcc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system