KEGG   Frankia sp. EuI1c: FraEuI1c_6326Help
Entry
FraEuI1c_6326     CDS       T01354                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_6326
   01230 Biosynthesis of amino acids
    FraEuI1c_6326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_6326
  Energy metabolism
   00680 Methane metabolism
    FraEuI1c_6326
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_6326
Enzymes [BR:fri01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FraEuI1c_6326
Exosome [BR:fri04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FraEuI1c_6326
  Exosomal proteins of melanoma cells
   FraEuI1c_6326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7785379..7786128)
Genome map
AA seq 249 aa AA seqDB search
MPTLVLLRHGESTWNQKNLFTGWVDVDLSEKGVKEATRGGELLREAGVLPDVVHTSVLTR
AMRTAWLALDAAGRLWIPVRRSWRLNERHYGDLQGRDKAETLEKFGEEQFMLWRRSYDTP
PPDITPGQESGVDDRYAELAPDLIPATECLKDVVVRMLPYWYDAIVPDLRAGSTVLVTAH
GNSLRALVKHLDSIGDADIAALNIPTGIPLRYELDDDLKVISSAYLDPDAAELAAAAVAA
QGKSRSKAR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccctcgtcctgctccgccatggcgaaagcacctggaaccagaagaatctgttc
accggctgggtggacgtcgacctgtccgagaagggcgtcaaggaggccacccgcggcggt
gagctgctgcgcgaggccggcgtgctgcctgacgtcgtgcacacgtccgtgctgacccgc
gcgatgcgcacggcctggctggccctcgacgccgccggccggctgtggatcccggtgcgg
cgcagctggcggctcaacgaacgccactacggtgacctgcagggccgggacaaggccgag
acgctggagaagttcggcgaggagcagttcatgctctggcgccgctcgtacgacaccccg
ccgccggacatcacaccgggccaggaaagtggcgtcgacgaccggtacgccgagctcgcg
cccgatctcatcccggcgaccgagtgcctcaaggacgtcgtcgtccggatgcttccgtac
tggtacgacgcgatcgtgcctgacctgcgggccgggagcacggtgctcgtcacggcccac
ggcaactcgctacgcgcgctggtcaagcacctggacagcatcggtgacgccgacatcgcc
gcgctgaacatccccaccgggatcccgctgcgctacgagctggacgacgacctgaaggtc
atctcgtccgcctacctcgacccggacgccgccgagctggccgccgccgccgtagccgcc
caagggaagagccgctcgaaggcgcgctga

DBGET integrated database retrieval system