KEGG   Frankia sp. EuI1c: FraEuI1c_6461Help
Entry
FraEuI1c_6461     CDS       T01354                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fri  Frankia sp. EuI1c
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FraEuI1c_6461
Enzymes [BR:fri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FraEuI1c_6461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7932283..7934505)
Genome map
AA seq 740 aa AA seqDB search
MPGSDGARWTLLDATLERVTFASEETGYTVAKVDPGRGGDLVTVVGSLLGAAPGEFLRMR
GRWGSHPQHGRQFQVEDYTTVLPATVQGIRRYLGSGLIKGIGPRLAENIVDHFGADALDV
IDTEPGRLIEVPKLGPKRVKAITAAWDEQRAIKEVMVFLQGVGVSTSLAVKIYKKYRDGS
VDVVRREPYRLASEVWGIGFKTADTIAQAVGIPHDAPERIKAGLQYTLSESTNDGHCYLP
EQRLLTDAAKILTVEVAQVIDALGELVTEEGVVREQLPGEDPAVPVVGYYLVPFHRAEVS
LAGQLRRLLHADTDRLGVFTTVDWDAAWRWLQGRTGVELAVAQREAVRLALTCKVAVLTG
GPGCGKSFTVRAIVEMATAKKAKVLLAAPTGRAAKRLTELTGHPAATVHRLLELRPGGDA
AYDRDRPLDADLVVVDEASMLDLLLANKLARAVAPGAHLLLVGDVDQLPSVGAGQVLRDL
LADGTPVPRVRLSQVFRQAAQSGVVTNAHRINAGEFPHVKGMADFFLFACEEAEDAAAMT
VDVVANRIPRRFGLDPRADVQVLAPMHRGHAGAGTLNGLLQEALTPGRPGTPERRFGGRV
FRVGDKVSQIRNNYDKGAAGVFNGTLGVVTALDPVEQTLTVRTDEGETISYDFTELDELV
HAYALTIHRSQGSEYPAVVIPVTMSAWMMLQRNLLYTAITRAKKLVVLVGSTKAISRAVH
TATAGRRYTRLAHRLHQTAP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgccggggtcggatggtgcgcggtggacgttgttggacgcgacgttggaacgggtgacg
ttcgccagtgaggagaccgggtacacggtcgcgaaggtcgatcctggccggggtggtgat
ctggtcacggtcgtcgggtcgctgttgggggcggcgccgggtgagttcctgcggatgcgg
ggccggtggggtagtcatccccagcatggccggcagttccaggtcgaggactacacgacg
gtcctgccagcgacggtgcagggcatccgccggtatctcggctccggtctgatcaaaggg
atcgggccgcggctcgcggagaacatcgtcgaccacttcggcgccgacgccctcgatgtg
atcgacaccgagcctggccggctgatcgaggttcccaagctcggcccgaaacgggtgaag
gcgatcaccgccgcctgggacgagcagcgggcgatcaaagaggtgatggtcttcctccaa
ggcgtcggtgtgtccacgtctctcgccgtgaagatctacaagaagtatcgggacgggtcg
gtggacgtggtccgccgggagccgtaccggctggcgagcgaggtgtggggcatcgggttc
aagaccgcggacacgatcgcccaggccgtcggtatcccgcacgacgcccccgagcggatc
aaggccgggttgcagtacacgctgtcggagtcgaccaacgacgggcactgctacctgccc
gagcagcggctcctcaccgacgcggcgaagatcctcaccgtcgaggtcgcccaggtgatc
gacgccctcggcgagctcgtcaccgaggaaggggtcgtgcgcgaacagctgccgggtgag
gacccggcggtgccggtcgtcggctactacctggtgccgtttcaccgggccgaggtgtcg
ttggccggccagctgcggcgtctgttgcacgccgacaccgaccggctcggcgtgttcacc
acggtggactgggacgcggcctggcgctggctgcagggccggacgggggtggagctggct
gtggcgcagcgggaggcggtacgcctcgccctgacctgcaaggtcgcggtcctgaccggg
gggccgggctgcgggaagagtttcacggtccgggcgatcgtggagatggcgacggcgaag
aaggcgaaggtgctgctggccgcgccgaccggtcgggccgcgaaacggctcaccgaactg
accggccacccggcggcgaccgtgcaccgcctgttggagctacgccccggcggcgacgcc
gcctacgaccgcgaccgccccctggacgccgacctggtggtggtcgatgaggcctccatg
ctcgacctgttgctggcgaacaagctcgcccgcgccgtcgcgccaggagcgcatctgctg
ctcgtcggggacgtcgaccagctaccgtccgtcggtgccggccaggtactgcgtgacctg
ctcgccgacggcacccccgtgccgcgtgtccggctgtcgcaggtgtttcgccaggccgcc
cagtcaggcgtcgtcaccaacgcccaccggatcaacgccggcgagttcccccacgtgaag
ggcatggcggacttcttcctgttcgcctgcgaggaagccgaggacgccgcggccatgacg
gtggacgtggtcgcgaaccggatcccgcgccggttcggcctcgatccccgcgccgatgtc
caggtcctcgcgcccatgcaccgcggccacgccggagccggcacgctcaacggcctgctc
caggaggcgctcaccccgggccggcccggcacgccggagcggcggttcggcgggcgggtg
ttccgggtcggcgacaaggtcagccagatccgcaacaactacgacaaaggcgccgccggt
gtcttcaacggcaccctcggcgtcgtcaccgccctcgaccccgtcgagcagaccctcacc
gtacgcaccgacgaaggcgagaccatcagctacgacttcaccgagcttgatgagctcgtc
cacgcgtacgcgctgacgatccaccgctcccagggcagcgaatacccggccgttgtcatc
ccggtcacgatgagcgcctggatgatgttgcaacgcaacctgctctacaccgccatcacc
cgcgccaagaaactcgtcgtcctcgtcggatcgaccaaagccatcagccgcgccgtccac
accgccaccgcgggccgccgctacacccgcctcgctcaccgcctgcaccagaccgccccg
tga

DBGET integrated database retrieval system