KEGG   Frankia sp. EuI1c: FraEuI1c_6867Help
Entry
FraEuI1c_6867     CDS       T01354                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fri  Frankia sp. EuI1c
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FraEuI1c_6867
DNA repair and recombination proteins [BR:fri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FraEuI1c_6867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8393166..8393765
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQDLIDELGALPGIGPKSAQRIAFHILAADPADVRRLAKALLEVKEKVQFCRICF
NVAQAELCRICADPRRDTTVICVVEESKDVVAVERTREFRGRYHVLGGAINPIGGVGPDD
LHIRELIARLADGTVTELILATDPNTEGEVTASYLARQIGPMGLTVSRLASGLPMGGDLE
WADEVTLGRAFEGRRVVAG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggcgtcgtccaggacctgatcgacgagctcggggcgctgcccgggatcggc
ccgaagagcgcgcagcgcatcgcgttccacatcctcgcggcggatccggccgacgtccgg
cggctggccaaggcgctgctcgaggtgaaggagaaggtccagttctgccggatctgcttc
aacgtggcccaggccgagctgtgccggatctgcgctgacccgcgtcgcgacaccacggtg
atctgcgtcgtcgaggagtcgaaggacgtcgtcgcggtcgagcgcacccgggagttccgc
ggcaggtatcacgtgctcggtggggcgatcaacccgatcggcggggtcggcccggacgac
ctgcacatccgtgaactgatcgcgcggctggcggatggcaccgtcacggagctgatcctc
gcgaccgacccgaacaccgagggcgaggtcaccgcgagctacctggctcgtcagatcggc
ccgatgggcctgacagtgagccggctggccagcggtctgccgatgggcggcgacctggag
tgggccgacgaggtcacccttggccgcgccttcgagggccgccgcgtcgtcgccggctag

DBGET integrated database retrieval system