KEGG   Frankia sp. EuI1c: FraEuI1c_6870Help
Entry
FraEuI1c_6870     CDS       T01354                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00010  Glycolysis / Gluconeogenesis
fri00071  Fatty acid degradation
fri00350  Tyrosine metabolism
fri00625  Chloroalkane and chloroalkene degradation
fri00626  Naphthalene degradation
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_6870
  Lipid metabolism
   00071 Fatty acid degradation
    FraEuI1c_6870
  Amino acid metabolism
   00350 Tyrosine metabolism
    FraEuI1c_6870
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FraEuI1c_6870
   00626 Naphthalene degradation
    FraEuI1c_6870
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FraEuI1c_6870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ADP84839
UniProt: E3IUM3
Position
complement(8395501..8396547)
Genome map
AA seq 348 aa AA seqDB search
MTAGPVMSGWQVAAPGPAAGGPLRRVEVPVPEPGPGQVRVRVLACGVCRTDLHLAEGDLA
PHRPFTIPGHEVVGRLDAVGPGVDAAALWPGLGPDGRLGIAWLAGTDGSCRYCRRGHENL
CPASTYTGWDVDGGYAEYAVVSAGYAYRLPSGYGDGELAPLLCAGIVGYRALRRAQLPPG
GRLGIYGFGASAHLAAQVALAEGATVHVMTRSADAQRLATELGAASVTGAYDAPPEPLDA
AVLFAPVGELVPVALEALDRGGTLSIAGIHLSDVPTLNYQRQLFQERSVRSTTANTRADG
REFLEIAARHRLAVTVAAYPLAAADQALTDLAADRVTGAAVLFPDPAS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggggcccgtgatgagcgggtggcaggtggcggctccggggccggcggcgggc
gggccgctgcggcgggttgaggtgcctgtgcccgagccggggccgggccaggtgcgggtg
cgggtgttggcctgcggggtgtgccggaccgacctgcatctggccgagggggatctggcg
ccgcaccggccgttcacgatcccggggcacgaggtcgtcggccggctcgacgccgtcggg
ccgggggtggacgcggcagcgctgtggcccggcctcggcccggacggccggctcggcatc
gcctggctggccgggaccgatgggagctgccggtactgccgtcggggccacgagaatctc
tgcccggcgtccacctacaccgggtgggacgtcgatggtggttacgccgagtacgccgtc
gtgagcgccggctacgcctaccggttgcccagcggctacggcgacggcgagttggccccg
ctgctgtgcgccgggatcgtcggctaccgcgcgcttcgccgggcccagttgccgccgggc
ggcaggctggggatctacggcttcggcgcgtccgctcacctcgccgcgcaggtggcgctc
gccgagggcgcgaccgtgcatgtgatgacccggtccgcggacgcccagcggctcgcgacc
gagctgggcgccgcgtcggtgaccggcgcctacgacgccccgccggagccactggacgcg
gccgtgctgttcgccccggtgggggagctggtgccggtcgcgctggaggcgctcgaccgg
ggcggaacgctctccatcgccgggatccacctctcggacgtcccgacgctcaactatcag
cggcagctgttccaggagcgctcggtgcgcagcacgacggccaacaccagggccgacggc
cgggagttcctcgagatcgcggcccggcaccgactggcggtcacggtcgcggcctacccg
ctggcggccgccgaccaggcgctgaccgacctcgcggccgaccgggtcaccggcgccgcc
gttctcttccccgatccggccagctga

DBGET integrated database retrieval system