KEGG   Frankia sp. EuI1c: FraEuI1c_6948Help
Entry
FraEuI1c_6948     CDS       T01354                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fri  Frankia sp. EuI1c
Brite
Enzymes [BR:fri01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FraEuI1c_6948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8491900..8493171)
Genome map
AA seq 423 aa AA seqDB search
MTDAGATDEQAARLRNKVVDDLVADGTIASPAVEAAMRRVPRELFAPGAELSAVYHPWNG
LVTKRDVGGRSLSSLSAPQAQAHMLEQARIEPGMNVLEVGSGGMNAAYLAELVGPSGRVV
TVDIDEFVTGRAARFLAQAGYPDVHVVLADAEAGVAEFAPFDRVLVTVGAWDIPPAWRDQ
LVEGGRLVVPLQVMGLMRTVAFEKASDLLVSDSAKQFGFVPMQGAGAHHSFELPLAGGAV
TLIFDEGAPADPAALACVLDSEPLVVDSGAGLRMGEPWATMQMWLATALPGFCRLSVDGE
RNEAATRPLPSRAIGFAVVQAGSAAYVVTRRLDGGDFTLDVYAHGPNAAGLAVTVAEQVR
IWDRDHRGGPGPRYLVVSAATPDAELPAGDRVIDKIHSRIVLSWPRPADSLTGQDTAHQP
LPL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatgccggggcgacagacgagcaggctgctcgtcttcgcaacaaggtcgtcgat
gatctcgtggccgacgggacgatcgcctcgccggctgtcgaggcagcgatgcgacgggta
ccccgggagctgttcgcgccgggggctgagctgagcgcggtctatcacccgtggaacggg
ctggtgacgaagcgggacgtgggtggccggtcgttgagttcgctgtcggcgccgcaggcg
caggcgcacatgttggagcaggcccggatcgagccggggatgaacgtcctggaagttggc
tccggtgggatgaacgccgcctacctggccgagctggtcgggccgtctggccgggtcgtg
accgtcgatatcgacgagttcgtcaccggtcgggccgcgcggttcctcgctcaggccggc
tacccggacgtgcacgtggtgcttgccgacgccgaggccggtgtggcggagttcgccccc
tttgaccgggtgctggtcacggtcggggcgtgggatatcccgccggcctggcgggatcag
ctggtcgagggcgggcggctggtcgtgccgttgcaggtcatgggtctcatgcgcaccgtg
gcgttcgagaaggccagcgacctgctggtctccgactcggcgaagcagttcgggttcgtc
ccgatgcagggagctggcgcgcatcacagcttcgagctgcccttggccgggggagcggtg
acgctgatcttcgacgaaggcgcgccggcggatccggcggcgctggcctgcgtgctcgat
tcggagccgctggtggtcgacagcggcgcgggccttcggatgggcgagccgtgggcgacg
atgcagatgtggctggccacagcgctgccgggcttctgccggctgagcgttgacggcgag
cggaacgaggccgcgacgcggcctttgcccagccgggccattgggttcgcggtcgtccaa
gccggcagcgccgcctacgtcgtgacccgccggctcgacggcggcgacttcaccctcgat
gtctacgcccacgggccgaacgccgcgggtctcgccgtgaccgtcgccgagcaggtgcgt
atctgggaccgggaccatcgtggcggcccgggaccgcgctacctcgtcgtttcggccgcg
accccggacgccgagcttccggcgggggaccgcgtcatcgacaagatccacagccggatc
gtcctgtcctggccccgtccggcggactcccttacgggccaggacaccgctcaccaaccc
ctcccactgtaa

DBGET integrated database retrieval system