KEGG   Frankia sp. EuI1c: FraEuI1c_7037Help
Entry
FraEuI1c_7037     CDS       T01354                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
fri  Frankia sp. EuI1c
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FraEuI1c_7037
   00051 Fructose and mannose metabolism
    FraEuI1c_7037
Enzymes [BR:fri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     FraEuI1c_7037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8598513..8599748)
Genome map
AA seq 411 aa AA seqDB search
MTSDLTTGALTASDLAASAPKSGDLVPTRADRFSFGLWTVGWQGRDPFGDATRPPLDPVE
SVHRLAELGAYGVTFHDDDLIPFAADNAERERCIKRFRSALDETGLVVPMMTTNLFTHPV
FKEGAFTANDRGVRRFALRKTMRNIDLAAEFGAKLYVAWGGREGAESDAAKDPRAALDRL
KEAVDTLCQYVRDRGYDIRFALEPKPNEPRGDILLPTIGHALAFINQLEYPEMVGLNPEV
GHETMAGLNVVHGYAQALWADKLFHIDLNGQHGLKYDQDLRFGTADVKSAFFLVDLLESA
GYDGPRHFDFKPPRAENIDGVWVSAAACMRTYLILKEKAAAFRSDPRVVAAQAAAGVGEL
STPTLAPGETLADLLADPAAYENFDADAAGTRAVNIEALDQLALEHLLGVA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgatctgacgaccggtgcgctgacagccagcgatctggcagccagtgcgccg
aagtccggtgatctggtgcccacgcgggcggaccggttcagcttcggcctgtggaccgtc
ggctggcagggacgcgatcccttcggcgacgcgacccggccgccgctcgacccggtcgag
agcgtgcaccggctcgccgagctcggcgcctacggcgtgaccttccacgacgacgacctg
atcccgttcgcggcggacaacgccgaacgggagcgctgcatcaagcggttccggtcagct
ctggacgagaccggcctggtcgtcccgatgatgaccacgaacctgttcacccacccggtg
ttcaaggaaggcgccttcaccgcgaacgatcgcggcgtccgccggttcgcgctgcgcaag
acgatgcgcaacatcgacctcgccgccgagttcggcgcgaagctctacgtcgcgtggggt
ggccgtgagggcgcggagagcgatgcggccaaggatccgcgcgcggccctcgaccgcctg
aaggaggccgtcgacacgctctgccagtacgtccgcgaccggggctacgacatcaggttc
gcgctcgagccgaagcccaacgaaccacgcggcgacatcctgctgcccacgatcggccac
gccctggcgttcatcaaccagctcgagtatcccgagatggtcggactgaacccggaggtc
ggccacgagacgatggccgggctgaacgtggtccacggctacgcccaggcgttgtgggcc
gacaagctcttccacatcgacctcaacggccagcacgggctcaagtacgaccaggacctg
cgcttcggcacggccgacgtcaagagcgcgttcttcctcgtcgacctgctggagagcgcc
ggctacgacggtccccgccacttcgacttcaagcccccgcgagcggagaacatcgacggc
gtctgggtgtcggcggcagcctgcatgcggacctacctgatcctcaaggagaaggccgcc
gccttccgctcggacccgcgcgtcgtcgcggcccaggcagcggccggcgtcggcgagctc
tcgaccccgaccctggcccccggcgagaccctcgccgacctgctggccgaccctgccgct
tacgagaacttcgacgccgacgccgcgggtacccgcgcagtcaacatcgaggccctcgac
cagctggccctggagcacctcctcggcgtcgcctga

DBGET integrated database retrieval system