KEGG   Faecalibaculum rodentium: AALO17_11880Help
Entry
AALO17_11880      CDS       T04268                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fro  Faecalibaculum rodentium
Pathway
fro00071  Fatty acid degradation
fro00280  Valine, leucine and isoleucine degradation
fro00310  Lysine degradation
fro00362  Benzoate degradation
fro00380  Tryptophan metabolism
fro00620  Pyruvate metabolism
fro00630  Glyoxylate and dicarboxylate metabolism
fro00640  Propanoate metabolism
fro00650  Butanoate metabolism
fro00900  Terpenoid backbone biosynthesis
fro01100  Metabolic pathways
fro01110  Biosynthesis of secondary metabolites
fro01120  Microbial metabolism in diverse environments
fro01130  Biosynthesis of antibiotics
fro01200  Carbon metabolism
fro01212  Fatty acid metabolism
fro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AALO17_11880
   00630 Glyoxylate and dicarboxylate metabolism
    AALO17_11880
   00640 Propanoate metabolism
    AALO17_11880
   00650 Butanoate metabolism
    AALO17_11880
  Lipid metabolism
   00071 Fatty acid degradation
    AALO17_11880
   00072 Synthesis and degradation of ketone bodies
    AALO17_11880
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AALO17_11880
   00310 Lysine degradation
    AALO17_11880
   00380 Tryptophan metabolism
    AALO17_11880
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AALO17_11880
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AALO17_11880
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AALO17_11880
Enzymes [BR:fro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AALO17_11880
Exosome [BR:fro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AALO17_11880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMK54322
UniProt: A0A140DUJ5
Position
complement(1079390..1080598)
Genome map
AA seq 402 aa AA seqDB search
MNKAYIVAAKRSAIGTFLGSLTNVPAAELGATVLKAAIAEAGIEPKDINEVIIGNVIGAG
LGQNIARHISLDAGIPESVPAHSINMVCGSGLEAIIEATIRIHAGWGDLFVAGGVENMSA
APYLLSGKNRTGTKMGNQTIVDAMTYDALTDAMNNVHMGVTAENIAKKYNITREMQDEFA
LASQEKALKAIADGKFKDEIVPIEVKQRKATVVFDTDEHPRATSLEKLAKLRPAFIKDGT
VTAGNASGINDGASMCIVASEEAVKKYNLKPIAEVIGCGQGGVDPLYMGLGPTPAILNAL
KQADLKLQDMDVIELNEAFASQSLGVVHELVEKTGIDRDELLKITNVNGGAIALGHPVGA
SGNRIFVSLLHEMVREKAKYGLASLCIGGGMGTAVVVKNCED
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagcctacatcgtcgctgccaagcgttccgccatcggtacatttctgggcagt
ctgaccaatgttcccgccgccgagctgggagccacagtcctgaaggcagccattgccgaa
gcaggcattgagcccaaggacatcaacgaagtcatcatcggcaacgtcatcggcgcaggc
ctgggccagaacatcgcccgccacatttccctggatgccggcattcccgaaagcgtgcct
gcccactccatcaacatggtctgcggatccggtctggaagccatcattgaagcgaccatc
cgcattcatgcaggctggggcgacctgttcgtggccggcggcgtggaaaacatgtccgct
gctccctacctgctgagcggcaaaaaccgcaccggcacaaaaatgggcaaccagacaatt
gtggatgccatgacctatgatgccctgacagacgccatgaataatgtacacatgggcgtg
actgcagaaaacattgccaagaaatacaacatcacccgtgaaatgcaggacgaatttgcc
ctggcatcccaggaaaaagccctgaaggccattgcagacggcaaattcaaggacgaaatc
gttcccatcgaagtaaaacagcgcaaggcaacggttgtcttcgacaccgatgaacacccc
cgtgccacgtccctggaaaaactggcgaaacttcgtccggccttcatcaaggacggcaca
gtcacagccggcaacgcatccggcatcaacgacggcgcttccatgtgtatcgtggcaagc
gaagaagccgtgaagaaatacaacctgaagcccattgccgaagtcatcggctgcggacag
ggcggcgtcgatcccctgtacatgggcctgggtcccacacctgcgatcctgaacgccctg
aaacaggcagacctgaagctgcaggacatggatgtcatcgagctgaacgaagccttcgca
tcccagtctctgggtgtggttcatgaactggtggaaaagacaggcatcgaccgcgatgaa
ctcctgaagatcaccaacgtgaacggcggcgccatcgccctgggtcaccccgttggtgca
tccggcaaccggatcttcgtttccctgctgcacgaaatggttcgtgaaaaagcgaaatac
ggtctggccagcctctgcatcggcggcggcatgggtaccgcagtcgttgtcaagaactgc
gaagattag

DBGET integrated database retrieval system