KEGG   Francisella sp. TX077308: F7308_0020Help
Entry
F7308_0020        CDS       T01560                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
frt  Francisella sp. TX077308
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:frt00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:frt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(20836..21762)
Genome map
AA seq 308 aa AA seqDB search
MLSFQKLLRGDQITKDDLYKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGASSSTQKGETLDDTGRMMDQYADIIVMRHPKPHSVEEFSKYV
HSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKIGFLGDLKYGRTVHSLTNILAKYN
ATFKFISSKELQIPEKLRDFVEKNGNSFSELEEVSAEALKDLDVLYVTRVQRERFPNEES
YLENKDLCYLDRKHISATSNFIILHPLPRVDEMDRSIDELECAKYFDQIKYSVPIRMSLL
SLLLKSQN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagcttctacgaggcgatcaaattactaaagatgacttatataaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagaacccatcaaagat
ttagaaggcaaaatactagcatctcttttctttgaaccaagtactagaacaaggttctct
tttgaatctgctatgaatagacttggtggtaaggttatatcactagaaaacggtgcttct
agctctacccaaaaaggcgaaacccttgatgacacaggtagaatgatggatcaatatgct
gacatcatagttatgcgtcatcctaagcctcacagtgttgaagaattctcaaaatatgtt
cactcacctgtgataaatgctggcgatggtgaaaatgagcaccctacccagtcattagtt
gatttatatactatctattctgagaaaggctctcttgataacctaaaaattggtttctta
ggagatctgaaatatggtcgtacagttcattcattaactaatatcttagctaaatataat
gctacatttaaatttatatcttcaaaagaactgcaaatccctgagaaacttagagatttt
gttgagaaaaatggtaattcttttagtgaactagaagaggtaagcgctgaagctctgaaa
gatttagatgtactatatgtaactcgtgttcaaagagagagatttccaaatgaagagagt
tatttagagaataaagatttatgctacttagatagaaaacatatttccgctactagcaac
ttcataatccttcatcctctaccaagagttgatgagatggatagatctatagatgagctt
gagtgtgcaaaatattttgatcaaatcaaatatagtgttcctattagaatgtctctgcta
tcattacttctaaaatcacaaaactaa

DBGET integrated database retrieval system