KEGG   Francisella sp. TX077308: F7308_0143Help
Entry
F7308_0143        CDS       T01560                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
frt  Francisella sp. TX077308
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:frt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146412..147239
Genome map
AA seq 275 aa AA seqDB search
MANIEPKNYQSYAKINLFLHILNKRDDGYHNLQSWFTFLDLKDHLSFRFNNYSKIEITSN
IQIASQEDNLIYKAVKEFQEAYNIENIGVDIDIIKNIPMGAGLGGGSSNAATTLIALRDY
YLPELSNEEMIPLAKKLGADVPIFLYGRSAWAEGIGDILYSKEFEQQYALLIKPNIHIST
KEFFESENLAKTKDILSKDLSFDTNTMHNAFENIFFTKHPEFKQYLYSIDDGFRMTGTGS
CFYLLSNNINKLQQLARKFDKPLDKWVVKTLNYAY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatatagaacccaaaaactatcaaagttatgcaaaaattaatttgtttttgcat
atattaaataagcgagatgatggatatcataatttacaaagctggtttacatttttggat
ctaaaagatcatcttagctttaggtttaataattatagtaagattgaaattacaagtaat
atacaaatagcttcccaagaagataatttgatttataaagctgttaaagagtttcaagag
gcttataatattgagaatatcggagttgatattgatattatcaaaaatataccaatgggt
gctggtctcggtggtggaagctcaaatgcagcaaccactttaatagcattacgagattat
tacttacctgagctatcaaatgaggagatgatacctttagctaaaaagcttggagcagat
gtgccgatatttctgtatggcagatcagcatgggctgaagggattggggatattttatac
tctaaggaatttgagcaacaatatgcactattaattaagcctaatattcatattagtacc
aaagagttttttgaaagtgagaatttagctaagacgaaggatatattatcaaaagatctg
agctttgatactaacactatgcataatgcttttgaaaatatattctttacaaagcatcct
gagtttaagcaatatttgtatagtattgatgatggttttagaatgacaggaactggatca
tgcttttatctactttctaataatattaataaactacagcaacttgcaagaaaatttgat
aaacctcttgacaaatgggtggtcaaaacattaaactatgcctactaa

DBGET integrated database retrieval system