KEGG   Francisella sp. TX077308: F7308_0207Help
Entry
F7308_0207        CDS       T01560                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
frt  Francisella sp. TX077308
Pathway
frt00330  Arginine and proline metabolism
frt00332  Carbapenem biosynthesis
frt01100  Metabolic pathways
frt01130  Biosynthesis of antibiotics
frt01230  Biosynthesis of amino acids
Module
frt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    F7308_0207
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    F7308_0207
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     F7308_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEI35135
UniProt: F8G8A0
Position
214078..215241
Genome map
AA seq 387 aa AA seqDB search
MFQIANELSKNMQRKELLNAVKRIVVKVGTSTLTHQTGLLNIYRIEKLIRQLSDLHNQGY
EVILVTSGAVGAGMGKLGLQQKPKTLPEKQAVAAVGQVALTHLYQKLFSEYGKNIAQLLL
TKDDVANRERYLNARNAFSALLAKGVIPIVNENDAVVVDEIKVGDNDTLSALVANLIDAD
LLIILSDIDGLYTANPRIDSSAKLLNIIPEISDDIRAMAGDVGSKFGTGGMATKIKAAEI
AVAGGVNMVIASGEDPKILLEIILGDDIGTLFAKNNKKEITAKKHWITYSSHKRGQIIID
KGAVTALKQNKSLLPCGIISINGDFQKGATVVVCSEDTQEIATGLVNYSSQDLAKIKGHK
SYNIANILGHCDYNEVVHVDNMFLKES
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcaaattgcaaatgaattatcaaaaaatatgcaaagaaaagagttactaaatgcg
gttaagagaatagttgtaaaagttgggactagtactctaactcatcaaacaggtctacta
aatatttatcgaatagaaaagctaattagacagttatcagacctacataatcaaggctat
gaagtaatacttgtaacatcaggagctgttggtgcgggtatgggtaagttagggctgcaa
caaaagccaaaaactctaccagagaagcaagctgtagcagcagtagggcaagtggctttg
actcatttatatcaaaagcttttctctgaatatggtaagaatattgctcagttgcttctg
acaaaagatgatgttgctaatagagaaagatacctaaatgcacgaaatgctttttcagct
ttattggcaaaaggagttatcccaatcgttaatgaaaatgatgcggtagtagttgatgag
attaaggttggtgataatgatactttatcggcattagttgcaaatttaatagatgctgat
ttattgattattctctcggatattgatggtctgtatacagcaaatccacgtatagatagc
tcagcaaaacttttaaatattatcccagaaatttcagatgatattcgagctatggctggt
gacgtgggttctaaatttggtacaggaggtatggctactaagattaaggcagctgagatt
gctgtggctggtggtgttaatatggttattgccagtggagaagatcctaaaattcttttg
gagataatattgggagatgatatcgggacattatttgcaaaaaataataaaaaagaaatt
acagctaaaaagcattggataacttatagtagccataagcgaggacaaattataattgat
aaaggagctgttacagccctaaaacaaaacaagagtcttttaccatgtggaattatttct
ataaatggagattttcaaaagggtgctacggttgttgtttgtagtgaagatactcaagaa
atagccactggactggttaattattcatcacaagatttggcaaaaatcaaaggacataaa
agttataatattgctaatattttagggcattgtgactataatgaagttgtccatgttgat
aatatgtttttaaaggagagttag

DBGET integrated database retrieval system