KEGG   Francisella sp. TX077308: F7308_0472Help
Entry
F7308_0472        CDS       T01560                                 

Definition
kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
frt  Francisella sp. TX077308
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_0472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7308_0472
   00052 Galactose metabolism
    F7308_0472
   00500 Starch and sucrose metabolism
    F7308_0472
   00520 Amino sugar and nucleotide sugar metabolism
    F7308_0472
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    F7308_0472
   00524 Butirosin and neomycin biosynthesis
    F7308_0472
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     F7308_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450412..451434
Genome map
AA seq 340 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLEDGLTQSIAIRKYKGANFNCLSDIIDKFLLEVDLVGQIDS
VCLAVAGFVANGEVQVTNLPWLVSEQYISEGLGIDKSKVKVINDFEAIGYGIESLDREKD
LITLQEGKKDDETLCAVVGAGTGLGMCLVSYDKDHNPRVYKTEGGHVDFSPVDDEQIQLF
RFMRRTFHRISPERFCSGYGIFNIYKYVVRNPLYDQPECQSLRRELFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALSSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSSMMKDFPVHIIMNTDVGLIGARTYAAGLVKVE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatctggagatatcggtggaactaatactagattagaggtttctcttcta
gaagatggattaacacagagcattgccatcaggaagtataaaggagcaaactttaattgt
ttgtctgatattattgataagttcttactagaagttgatctagtggggcagattgattct
gtgtgtcttgctgttgctggatttgtcgcaaatggagaagttcaagtaacaaatttacca
tggttagtctcagagcagtatatctcagaaggccttgggatagataaaagtaaagttaaa
gttataaatgactttgaagccataggttatggtatagaatctttagatagagaaaaagat
cttattactctccaagaaggtaaaaaagatgatgaaacattgtgtgctgtagtcggtgct
ggtacaggtctaggtatgtgtctagttagttatgataaagatcataatcctagagtgtac
aaaactgaaggtgggcatgttgacttttcaccagttgatgatgagcaaattcaactcttt
agatttatgcgtagaacgtttcatcgtatatcaccagagagattttgcagtggctatggt
attttcaatatatataagtatgttgtacgtaatcctttatatgatcagccagagtgtcaa
tcgctacgaagagaattatttagcgtatcagattctgataaagcagcagttattgttaag
tatgccatagagcatagagaaccttctgcgttgagaactatagatatatttttaagtata
tatggatcagtggcaggtaatttagcattatcaagtttaccttttagagggttgtacatc
gctggaggtattgcacctagacttatcaaacaaatcaaagaaagtaagtttttagagaag
tttagagataaaggtagaatgtctagtatgatgaaagattttccagttcatataattatg
aatacagatgttggtttaattggtgcgcgtacttatgcagccggcttagtcaaagtagag
taa

DBGET integrated database retrieval system