KEGG   Francisella sp. TX077308: F7308_0501Help
Entry
F7308_0501        CDS       T01560                                 

Definition
Protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
frt  Francisella sp. TX077308
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489025..489645
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAEIMADIPREIFLPKEYQSLAYCDTNLVIDDRELR
SPMFTARLIEALAMKKTDNILKLGLETGYPVALIANLCNSVELVDYDEERLATARRNLAK
IDVYNVEFNSAEHLTNIIKNAKKYNCIYISNVVEENEVDESLLDLLEVGGRLVFVVRTDV
CDKAYLITKTVKETHQKSFLFNVYNR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagagaatatggtaaagcaacaagtcctcacggaaggtctt
tctttagatggtgttgcagagattatggcggatatccctagagagatttttctacccaag
gagtatcaatctttagcatactgtgatactaatcttgtgatagatgatagagagcttaga
agccctatgtttacagctaggctaatagaagctttggctatgaaaaaaactgataatata
ttaaaacttggtttagaaactggatatccagtagcgttgatagcaaatctatgcaatagc
gttgaacttgttgattatgatgaagaaagactagctacagcaaggcgtaatttagcaaaa
atagatgtttataatgtcgaatttaatagcgctgagcatcttacaaacattataaagaat
gccaagaaatataattgtatatatatatcaaatgttgtagaagaaaatgaggtggatgag
tctctgctagatcttcttgaggttggtggtagattagtttttgttgtaagaactgatgtg
tgtgacaaagcttaccttataactaaaacagtaaaagaaacgcaccaaaagagttttctt
tttaatgtttataatagataa

DBGET integrated database retrieval system