KEGG   Francisella sp. TX077308: F7308_0573Help
Entry
F7308_0573        CDS       T01560                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
frt  Francisella sp. TX077308
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_0573
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F7308_0573
   00650 Butanoate metabolism
    F7308_0573
  Energy metabolism
   00190 Oxidative phosphorylation
    F7308_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567875..568228
Genome map
AA seq 117 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVIIAAYFGYLIVEALCLSYSGTLNYDSWRGLFTDGMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKCAWASALVMLSFVLVYVFCFFWLFAVLFFY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatttcattaacttcatcgggtattaaagacttttttgtacaaagagttact
gcagtaattattgcggcttattttggttatcttatcgttgaggctttatgtttgtcctac
tcaggaactcttaattacgatagctggagaggtttgtttactgatggtatgttcttcaga
gttgctacattgatggcttatttggcaatgttttttcatgcttgggtaggtatttggatt
atctgtggtgactacattaagtgtgcttgggcatcagctcttgttatgctgagttttgtt
ttagtttatgtattctgctttttttggttgtttgcagttttatttttttactaa

DBGET integrated database retrieval system