KEGG   Francisella sp. TX077308: F7308_0577Help
Entry
F7308_0577        CDS       T01560                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
frt  Francisella sp. TX077308
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_0577
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F7308_0577
  Amino acid metabolism
   00310 Lysine degradation
    F7308_0577
Enzymes [BR:frt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     F7308_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
573616..575088
Genome map
AA seq 490 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKNEGDFVEEGDIIAEIETDKVVMEVPATASGVLKGIKK
HEGDTVLSEESLASIDTEAVAADSAQEVVATEETAQATQSSGKEIDVKAPVFPESVADGT
VSEWHKQEGEAVAEGDILAEIETDKVVMEVPATSNGVLSKILKPAGETVLSSELIAKISE
GAAVATVAKEEVKSQADSTGNDPHLVPSARKAFNSSGLESAASIEGTGKKGRITSEDVKK
AASSSKPQQPTVVANQGPRYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMTAVME
LRKKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNFFDIGIAVGT
DRGLVVPVLRDTDSKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLST
PIINSPQSAILGMHNIVERPMVVNGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELL
EDPNRILLQV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgtttccggagtccgttgcagatggcacattagctcaa
tggaataagaatgaaggcgactttgttgaagaaggtgatattatcgctgaaattgaaact
gataaagtagttatggaagttccagcgacagcgagcggagtccttaaaggcattaaaaag
catgaaggagatactgtgctttctgaagaatctttagcaagcattgatacagaggctgtg
gctgctgactctgctcaagaagtggttgctactgaagaaacagctcaggctacacaatca
tcaggcaaggagatcgatgttaaagcacctgttttcccagagtctgttgcagatggtaca
gtttctgagtggcataagcaagaaggtgaagctgttgccgaaggtgatattttagctgag
atagagactgataaagtagttatggaagttccagcgacatcaaatggtgtattgtctaaa
atattgaaacctgctggtgaaacagttctttcatcagaattaattgcaaaaatttcagaa
ggtgcagctgttgctacagtagccaaagaagaagtgaaatctcaagctgatagcacaggt
aatgatccgcatctagtcccttctgcgcgtaaggcatttaattcaagtggattagaatct
gccgctagtatcgaaggtactggtaaaaaggggcgtataacatctgaagatgttaaaaag
gcagcatctagtagtaaaccacaacagccgactgtagttgctaatcaaggtccaagatat
gaaaaaagagttaaaatgactcgtctgcgtcaaacaattgcaaacaggttagttgaagtt
caacatactaatgcgattttgactacttttaatgaagtagatatgacagcagttatggag
cttagaaaaaaatataaagacatgtttgtcaaagagcatgatactaagcttggatttatg
tcattctttataaaagctgcgactgaagctcttaagaagtttccggatgttaatgcttca
attgatggtgatgaaattgtttatcataacttctttgatatcggtattgctgttggtaca
gatagaggtttagtagtaccagttttaagagatactgacagtaaatccttagcggagcta
gaggctgatgtgcttgataaagcaattaaaggtcgtgatggtaagttaagcttagaagat
atgcaaggcggtacgttcactatcactaatggtggtacctatggatctatgctatctaca
ccaatcattaactcaccacagagtgcaatcttaggtatgcataacattgtcgaaagacct
atggtagttaatggtgagatcaaaatacgtccaatcatgtacttggcattatcttatgat
catagaattattgatggtggaacatctgtaagatttttaaagatgatcaaagaattgctt
gaagatcctaatagaattcttttacaagtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system