KEGG   Francisella sp. TX077308: F7308_0580Help
Entry
F7308_0580        CDS       T01560                                 

Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
frt  Francisella sp. TX077308
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_0580
   01230 Biosynthesis of amino acids
    F7308_0580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7308_0580
   00051 Fructose and mannose metabolism
    F7308_0580
   00562 Inositol phosphate metabolism
    F7308_0580
Enzymes [BR:frt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     F7308_0580
Exosome [BR:frt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   F7308_0580
  Exosomal proteins of bladder cancer cells
   F7308_0580
  Exosomal proteins of melanoma cells
   F7308_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
577014..577760
Genome map
AA seq 248 aa AA seqDB search
MGNWKMNGNSASIEELCRGISQAEYNSNKVAVAVFPSSVYIKEVLAQLPKEIGVGLQNIT
FYNNGAYTGELSVDMLHDIGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVVPVVCI
GESLEDRQGGRLERVLSTQLSLILENLSIEQLAKVVIAYEPVWAIGTGVVASLEQVQETH
QFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEFNEIIN
QANKICTE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggcaattggaagatgaatggtaactctgcaagcatagaagagctttgtagaggtatt
tcacaagcggagtacaatagtaacaaagtcgctgtagctgtgtttccatcaagtgtatat
atcaaagaggtgcttgcacaacttcctaaagaaattggagtaggtctacaaaatattact
ttttataataatggtgcatatactggagagctatcagttgatatgcttcatgacattgga
tgtaattatctacttataggacattctgaaagaagatctttgtttggtgagactgatcaa
gatgttttcaaaaaacttaataagattatagatacatcagttgtgccagttgtttgtata
ggtgagtcactagaagatagacaaggtggaaggttagaaagagtattatcaacacaatta
agtctaatactagaaaatttgtctattgagcaacttgctaaggttgtaatagcgtatgaa
cctgtttgggctataggtacaggagttgtagcatcattagaacaggtgcaagaaacacat
cagtttattcgttcgctagtggccaaagtagatgaaaatcttgctaaaaatatgaaaata
gtgtatggtggtagcctaaaagctgaaaatgctaaagatatattaagcctaccagatgtt
gatggtggtttgattggaggagcatcattgaaagcttctgagtttaacgaaataataaat
caagcaaataaaatatgtacggaataa

DBGET integrated database retrieval system