KEGG   Francisella sp. TX077308: F7308_0630Help
Entry
F7308_0630        CDS       T01560                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
frt  Francisella sp. TX077308
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    F7308_0630
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     F7308_0630
Exosome [BR:frt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F7308_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632339..633838
Genome map
AA seq 499 aa AA seqDB search
MSKEFILAVDQGTTSSRAIIFDKQGNIKKIAQKEFTQIYPKNGWVEHDPMEIWASQSSIV
REALEYARVSPRDIAAIGITNQRETTVVWDKNTGQPVYNAIVWQCRRTSHICDEINKDKE
FTNYIRKNTGLVVDAYFSGTKVKWILDNVDGARGKAEKGDLLFGTIDTWLIWNLTKGEVH
ATDFSNASRTMLFNINTLEWDKKILEYLDIPVSMLPEVRSSSGDFGHTHPSTLGGARIPI
AGVAGDQQSALFGHCCFEEGMAKNTYGTGCFALMNVGDKPVFSDAGLLTTIAWAENGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTDGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTRREHIIRAALEAIAYQAKDVLDCMKEGTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSKISKPKINEITGLGAVFLAGLSVGFWKDKEELKSILTTEKTFEPQKDPQTV
AHDYKGWKKAVDRSKAWAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaatttatattagcagtagaccaggggaccactagttctcgtgctattatc
tttgataagcaaggtaatattaaaaagatagcgcaaaaagaatttactcaaatttaccca
aagaatggttgggtagagcatgaccctatggaaatttgggcatcgcaaagtagtattgtt
agagaagctctagagtatgctagagtttctccgcgagatatagctgcaataggtattact
aaccaaagggaaaccacagtagtttgggataagaatacaggccagccagtttataatgct
atagtttggcagtgccgaagaacatctcatatctgtgatgaaatcaataaagataaagaa
tttactaattatattcgtaaaaatacaggtcttgtggtcgacgcatatttctccggtaca
aaagttaagtggatacttgataacgtagatggtgctaggggaaaagcagaaaaaggagat
ttactttttggaacaatcgatacttggttaatctggaatttaactaaaggtgaagttcac
gctactgacttttcaaatgcttcaagaacaatgttattcaatatcaatacacttgaatgg
gacaaaaaaattctagagtatttagatattcctgtatcaatgctaccagaggttagatct
tcaagtggcgattttgggcacactcatccaagtactttgggcggcgctagaattccaata
gctggtgtggcaggtgaccagcagtcagctttatttggtcattgctgttttgaggaaggt
atggcgaaaaacacttatggtacagggtgctttgctttaatgaatgttggtgataaacct
gtgttttctgatgcagggctccttacgactattgcttgggctgagaatggtaagccaact
tatgctcttgaaggtagtgtatttatcgcgggagcagttattcaatggattcgtgatggt
ctaggtcttgtacgctctgctgaagatagtgagtactatgctacaaaaattgattcaacg
gatggtgtttatttggtcccagcttttgttggtctcggtacgccatactgggatatgtat
gctcgagggactattgttggtattactcgtgatactaggcgggagcatatcataagggca
gcacttgaggctatagcttaccaggcaaaagatgttttagattgtatgaaagaaggcacg
ggtcttgatttagcagggcttcgagtagatggtggagcggttcaaaataattttctaatg
cagttccagtcagatatactacaatcaaagatttccaagcctaaaattaatgagattaca
ggtttgggggctgtgttcttagcgggtctatctgtaggtttttggaaagataaagaagaa
ttgaaatctattctcacaacagagaagacttttgagccacaaaaagaccctcaaacagta
gcccatgattataagggttggaaaaaagcagtagatagaagtaaggcttgggctgagtaa

DBGET integrated database retrieval system