KEGG   Francisella sp. TX077308: F7308_0784Help
Entry
F7308_0784        CDS       T01560                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
frt  Francisella sp. TX077308
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_0784
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7308_0784
   00020 Citrate cycle (TCA cycle)
    F7308_0784
   00620 Pyruvate metabolism
    F7308_0784
Enzymes [BR:frt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     F7308_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807202..808290
Genome map
AA seq 362 aa AA seqDB search
MGDKVAQGTLILKVKTQGSAPAAAPSQVAKSEAPKQESAKLAPAPVAQSSVNEYAVDNSN
AHASPAVRKLARILNVDLSKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKVAASGSGLDL
LDDPVVDFSKFGEIETQPLTRINKISAKNLHRNWVKIPHVTFYDDADVTDLEEFRKAKKG
FAEKMGVKITPLSFLVKAAAVALQEFPRMNSSLSNDGENLILKKYYNIGFAADTPAGLMV
PVIKDADKKGIIEISKDIMELAGKARDGKLGSKDMSGATFTISSIGVLGTTAFTPIINMP
EVAIMGVSKTAVKPIWNGKEFEPRTMLPLSMSADHRVIDGALAAKFLTRYSQILSDLREI
IM
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgataaggttgctcaaggtactctaattcttaaagtcaaaacacaaggttcagct
cctgctgcagctcctagtcaagtggctaaatctgaagcgcctaagcaagaatcggcaaaa
ctagctcctgcaccagtagcgcaaagtagcgtaaatgagtatgcggtagataactctaat
gctcacgcttcaccagcggttagaaaactagccagaatcttgaatgttgatttaagtaag
gtcaaagcaactggtcgtaagggtcgtgtaacgaaagaagactgttataattatatcaag
catgctgtaacacaagtccagactggtaaagttgctgcaagtggaagtggtttggatctt
ttggatgatccagttgttgatttctctaaatttggtgagattgaaactcagcctctaact
cgcatcaataaaatcagtgcgaaaaacttacatagaaactgggtaaaaattcctcatgta
actttctacgatgatgcggatgttacagatcttgaagagtttagaaaagctaaaaaaggt
tttgctgagaaaatgggtgttaagattactccattatcattcttggtaaaagctgctgct
gtagctctacaagagttcccaagaatgaacagctcattatcaaatgatggtgagaattta
atattgaagaaatattacaatattggttttgctgcagatactccagctggtcttatggtt
ccagttatcaaggatgctgataagaaaggtattatagaaatatcaaaagatattatggag
ctagctggtaaggctcgtgatggtaaattggggtctaaggatatgtctggtgctacattt
actatttcaagtatcggcgtgttaggtactacagcatttacaccaattataaatatgcct
gaagttgctattatgggtgtatctaagacagctgttaaaccaatttggaatggtaaagaa
tttgaacctagaactatgttgccactatctatgtcagcagatcatagggttattgatggt
gcactagctgctaagttcttgacaagatatagtcagattttatctgatttacgtgaaatc
ataatgtaa

DBGET integrated database retrieval system