KEGG   Francisella sp. TX077308: F7308_0784Help
Entry
F7308_0784        CDS       T01560                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
frt  Francisella sp. TX077308
Pathway
frt00010  Glycolysis / Gluconeogenesis
frt00020  Citrate cycle (TCA cycle)
frt00620  Pyruvate metabolism
frt01100  Metabolic pathways
frt01110  Biosynthesis of secondary metabolites
frt01120  Microbial metabolism in diverse environments
frt01130  Biosynthesis of antibiotics
frt01200  Carbon metabolism
Module
frt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7308_0784
   00020 Citrate cycle (TCA cycle)
    F7308_0784
   00620 Pyruvate metabolism
    F7308_0784
Enzymes [BR:frt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     F7308_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AEI35711
UniProt: F8GBE4
Position
807202..808290
Genome map
AA seq 362 aa AA seqDB search
MGDKVAQGTLILKVKTQGSAPAAAPSQVAKSEAPKQESAKLAPAPVAQSSVNEYAVDNSN
AHASPAVRKLARILNVDLSKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKVAASGSGLDL
LDDPVVDFSKFGEIETQPLTRINKISAKNLHRNWVKIPHVTFYDDADVTDLEEFRKAKKG
FAEKMGVKITPLSFLVKAAAVALQEFPRMNSSLSNDGENLILKKYYNIGFAADTPAGLMV
PVIKDADKKGIIEISKDIMELAGKARDGKLGSKDMSGATFTISSIGVLGTTAFTPIINMP
EVAIMGVSKTAVKPIWNGKEFEPRTMLPLSMSADHRVIDGALAAKFLTRYSQILSDLREI
IM
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgataaggttgctcaaggtactctaattcttaaagtcaaaacacaaggttcagct
cctgctgcagctcctagtcaagtggctaaatctgaagcgcctaagcaagaatcggcaaaa
ctagctcctgcaccagtagcgcaaagtagcgtaaatgagtatgcggtagataactctaat
gctcacgcttcaccagcggttagaaaactagccagaatcttgaatgttgatttaagtaag
gtcaaagcaactggtcgtaagggtcgtgtaacgaaagaagactgttataattatatcaag
catgctgtaacacaagtccagactggtaaagttgctgcaagtggaagtggtttggatctt
ttggatgatccagttgttgatttctctaaatttggtgagattgaaactcagcctctaact
cgcatcaataaaatcagtgcgaaaaacttacatagaaactgggtaaaaattcctcatgta
actttctacgatgatgcggatgttacagatcttgaagagtttagaaaagctaaaaaaggt
tttgctgagaaaatgggtgttaagattactccattatcattcttggtaaaagctgctgct
gtagctctacaagagttcccaagaatgaacagctcattatcaaatgatggtgagaattta
atattgaagaaatattacaatattggttttgctgcagatactccagctggtcttatggtt
ccagttatcaaggatgctgataagaaaggtattatagaaatatcaaaagatattatggag
ctagctggtaaggctcgtgatggtaaattggggtctaaggatatgtctggtgctacattt
actatttcaagtatcggcgtgttaggtactacagcatttacaccaattataaatatgcct
gaagttgctattatgggtgtatctaagacagctgttaaaccaatttggaatggtaaagaa
tttgaacctagaactatgttgccactatctatgtcagcagatcatagggttattgatggt
gcactagctgctaagttcttgacaagatatagtcagattttatctgatttacgtgaaatc
ataatgtaa

DBGET integrated database retrieval system