KEGG   Francisella sp. TX077308: F7308_0784Help
Entry
F7308_0784        CDS       T01560                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
frt  Francisella sp. TX077308
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:frt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:frt00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:frt00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:frt00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807202..808290
Genome map
AA seq 362 aa AA seqDB search
MGDKVAQGTLILKVKTQGSAPAAAPSQVAKSEAPKQESAKLAPAPVAQSSVNEYAVDNSN
AHASPAVRKLARILNVDLSKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKVAASGSGLDL
LDDPVVDFSKFGEIETQPLTRINKISAKNLHRNWVKIPHVTFYDDADVTDLEEFRKAKKG
FAEKMGVKITPLSFLVKAAAVALQEFPRMNSSLSNDGENLILKKYYNIGFAADTPAGLMV
PVIKDADKKGIIEISKDIMELAGKARDGKLGSKDMSGATFTISSIGVLGTTAFTPIINMP
EVAIMGVSKTAVKPIWNGKEFEPRTMLPLSMSADHRVIDGALAAKFLTRYSQILSDLREI
IM
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgataaggttgctcaaggtactctaattcttaaagtcaaaacacaaggttcagct
cctgctgcagctcctagtcaagtggctaaatctgaagcgcctaagcaagaatcggcaaaa
ctagctcctgcaccagtagcgcaaagtagcgtaaatgagtatgcggtagataactctaat
gctcacgcttcaccagcggttagaaaactagccagaatcttgaatgttgatttaagtaag
gtcaaagcaactggtcgtaagggtcgtgtaacgaaagaagactgttataattatatcaag
catgctgtaacacaagtccagactggtaaagttgctgcaagtggaagtggtttggatctt
ttggatgatccagttgttgatttctctaaatttggtgagattgaaactcagcctctaact
cgcatcaataaaatcagtgcgaaaaacttacatagaaactgggtaaaaattcctcatgta
actttctacgatgatgcggatgttacagatcttgaagagtttagaaaagctaaaaaaggt
tttgctgagaaaatgggtgttaagattactccattatcattcttggtaaaagctgctgct
gtagctctacaagagttcccaagaatgaacagctcattatcaaatgatggtgagaattta
atattgaagaaatattacaatattggttttgctgcagatactccagctggtcttatggtt
ccagttatcaaggatgctgataagaaaggtattatagaaatatcaaaagatattatggag
ctagctggtaaggctcgtgatggtaaattggggtctaaggatatgtctggtgctacattt
actatttcaagtatcggcgtgttaggtactacagcatttacaccaattataaatatgcct
gaagttgctattatgggtgtatctaagacagctgttaaaccaatttggaatggtaaagaa
tttgaacctagaactatgttgccactatctatgtcagcagatcatagggttattgatggt
gcactagctgctaagttcttgacaagatatagtcagattttatctgatttacgtgaaatc
ataatgtaa

DBGET integrated database retrieval system