KEGG   Francisella sp. TX077308: F7308_0827Help
Entry
F7308_0827        CDS       T01560                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
frt  Francisella sp. TX077308
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:frt01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:frt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850654..851523
Genome map
AA seq 289 aa AA seqDB search
MKKVEAVGIAIGNAGREIGCGRAPYALLNELRDRRIDAQIINYIGGRAEVPTMGKYFTKV
AQAVSEILKEGKFPLALGGDHSCAIGTWSGVYDYLKDQKKELGLIWIDAHMDSHRPETSE
TGNIHGMPVAHLLGYGHEELTKVLSDNPKLKPENIVFFGIRSYEKPERDFLEKLGVKVYY
QSDLTDRNFEELFSQEFERLEKITEGNVGISFDLDGLDPTNLDAVGTPVENGIAPQVFYK
TIEKINFNSLVCFEVAEYNPLIDKTEISLKYMSKLIRLVEGSIKNLTQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagaagctgtaggaatagctattggtaatgctggcagagaaattggttgt
ggaagagcaccatacgctttgttgaatgaactaagagatagacgtatagatgcacaaatt
atcaactatattggtggtagggctgaagtaccaactatgggtaagtattttactaaggtt
gctcaggcggtatctgagattcttaaagaaggtaagtttcctttggctcttggaggagac
cactcatgtgcaataggtacatggagtggggtttatgactaccttaaagatcagaaaaaa
gaacttggtttgatttggattgatgcgcatatggatagccataggccagaaacttctgag
actggtaatatacatggtatgcctgtagcacatcttttaggatatgggcatgaggaatta
acaaaagtactaagtgataatccaaagttaaagcctgagaatattgttttctttggaatt
cgttcttatgaaaagccagaaagagactttttggaaaaattaggagttaaggtttattat
caaagtgatttaaccgatagaaactttgaagagttattttcacaagaatttgaacgtctt
gagaagattacagagggtaatgtcgggattagttttgatttagatggtttagatcctact
aatcttgatgctgtaggaactccagttgaaaatggtattgcccctcaggttttttacaag
actattgaaaaaattaattttaatagtttggtatgttttgaagtggcagaatataatccc
ctgattgataaaacagaaatctctcttaaatatatgtcaaaactaataagattagttgaa
ggcagtataaaaaatctaactcaaaaatag

DBGET integrated database retrieval system