KEGG   Francisella sp. TX077308: F7308_0948Help
Entry
F7308_0948        CDS       T01560                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
frt  Francisella sp. TX077308
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    F7308_0948
Enzymes [BR:frt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     F7308_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969031..969789
Genome map
AA seq 252 aa AA seqDB search
MKILVCRPKDDADILSKLLISKGYDTVCLPCINIDYINVESSVLSYTSYIFTSKYAVESL
FAQYNPELFDGKKIYSVGQSTAKTLKKYGLDAIYPHDHGSQELLKLILEEDVYDDSFAVI
SGVSGNELLVKEISQLTKCDKFETYQRVFESVATLSQAYLKFIDDGINPNVIVTTSIDIF
KSLNRIFDEIVAPEAAIVTITSPKMLEFVNEQGFENTLSLERLDNDYICQKVREHIEAKN
VTRKKYSARASE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttgtttgtagacctaaagatgatgctgatattctctcaaagctattaata
tctaaaggctatgatactgtatgcttaccatgtattaatattgattatataaatgttgaa
agttcagtgttgagctatacaagttatatatttactagcaaatatgctgtagaaagctta
tttgctcaatataatcctgaattgttcgacggtaaaaaaatttatagtgtaggtcaaagc
actgcaaaaactctaaaaaaatatggtttagatgctatatatccacatgatcatggttca
caagagcttttgaaactaatcttggaagaagatgtttatgatgatagttttgcggttatc
tctggggtttctggaaatgaattgcttgtcaaagagatatcgcaactaacaaagtgcgat
aaatttgagacttatcagagagtttttgagagtgttgctacgcttagtcaagcgtattta
aaattcattgatgatggtataaatcctaatgttattgtcaccacaagtatcgatattttt
aagtctttgaataggatttttgatgaaatagtagcgcctgaggctgcaattgttaccata
acaagtccaaaaatgctagaatttgttaatgaacaaggctttgaaaatactttgagtctt
gaaagattagacaatgattatatctgtcaaaaagtacgagaacatatagaggcaaaaaat
gtcacaagaaaaaaatattcagcaagagcaagcgaatga

DBGET integrated database retrieval system