KEGG   Francisella sp. TX077308: F7308_0969Help
Entry
F7308_0969        CDS       T01560                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
frt  Francisella sp. TX077308
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:frt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    F7308_0969
Enzymes [BR:frt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     F7308_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995165..996940
Genome map
AA seq 591 aa AA seqDB search
MYKTFHQACEQLADIRAIDFFFAKEVFDLVKKTTPSIITLSSELYPPLHGAKGNNLEQKS
NEVLFHILIKLMHVYSHGHSCLKIVNISNKTIFASEKTNQSDAKVGFKMPSFDEIVSIFE
SLDYDKLPIYFAKEYDSLYIKRLWNYEVEIANFIKSRTIQNTQQDNHIEEVVDKLFEPAD
EIDWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMSNQNQQRIALLAPTGKAAQ
RMTESLNSVLSKRVDSDNYLGLSNLEAQTIHRFLGLRPNSTHVKYNEQSKAPYDVIIVDE
ASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSLFANFTHHRDGDITPYTTLLIK
NYRSQQYINNLAASVLKGDINIDSHQNENINFHSIRNLDTYLRDYAKRYSQLEKCRDYKE
ALTELNKFRILVANKNLEIGTDKLNQKIEKFMCKPIDSNYKGKPIMITQNSYSLGLFNGD
VGIIWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYVMTIHKTQGSEFDEIVIVLPAEDN
EALSKQLLYTAITRAKHKLTIISEQSSLRDIAQKDIKRNSNISELVSLSTQ
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccatcaagcttgtgagcaattagcagatattagagctatagatttt
ttctttgctaaagaagtgtttgatttagtcaaaaagactactccatctataatcacttta
tcaagtgagttatatccaccccttcacggagcgaaggggaacaatttggaacaaaaaagt
aatgaagttttatttcatattttgataaagcttatgcatgtatatagccatggtcatagc
tgtttgaagatagtaaatatatcaaataaaactatttttgcttcagagaaaactaatcaa
agcgatgctaaagtaggctttaaaatgccaagttttgatgaaattgtaagtattttcgag
tccttagattatgataaattacctatatattttgctaaagagtatgattccttatatatc
aaaagattgtggaattatgaggttgaaatagctaactttataaaatcaagaacaatccaa
aatactcaacaagataaccatattgaagaagttgtagataagctgtttgaacctgctgat
gagatagattggcaaaaacaggcagttatcaaaagtctaaattataattttagtattatc
tcaggtgggcctggtacaggtaagacaactacagtcgcaaagcttttgcttgctatacaa
atgagtaatcaaaatcagcaaagaatagctcttttagcaccaacaggtaaggctgcccag
agaatgacggaatccttaaatagtgtattaagtaaaagggtagacagtgataattattta
ggattatctaatctagaagctcaaactatacatagatttttaggcttaaggccaaactct
actcatgttaaatataacgagcagtcaaaagcaccatacgatgtgattattgttgatgaa
gcttcgatgcttgatatgaatatctttattaagttgattagagcagttgctgataatacc
aagctaattttgataggtgatactaatcagttaccatcagttgaggctggtagtcttttt
gcaaactttacacaccacagagatggagatattacgccatatacaacattacttatcaaa
aactatcgttcacaacaatatataaataatcttgcagcctcagttctaaaaggtgatatt
aatattgatagtcatcaaaatgagaatattaattttcatagcataaggaatttagatact
tatttaagagattatgcaaagagatattcacagcttgaaaagtgccgtgactacaaagag
gctcttaccgagctaaataaatttagaatacttgtagctaataaaaatctagaaattggt
acagataagttaaatcagaaaattgagaaatttatgtgtaaacctatagattctaactat
aagggtaaaccaattatgataactcaaaatagttattcattgggattattcaatggagat
gtagggattatctggccagatgatactggtaagcttcgagcttattttgatggtaaagat
gctaaggcttttagtctaaatatgctaccaaaatatgaaagtgtctatgtgatgacaatt
cataagacgcaaggttcagagtttgatgaaatcgtgattgttcttccagcagaagataat
gaagcgttaagtaaacaacttttgtatacagctattaccagagcgaaacataaattaacg
attatttctgaacaaagtagtttaagagatattgctcagaaagatattaagagaaattca
aatattagtgaattggttagcttgagcactcaatag

DBGET integrated database retrieval system