KEGG   Francisella sp. TX077308: F7308_1129Help
Entry
F7308_1129        CDS       T01560                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
frt  Francisella sp. TX077308
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:frt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1159377..1159979)
Genome map
AA seq 200 aa AA seqDB search
MDSKIFSPKITAVMESLRKLPTIGKKSSQRLTLHLLDKSPETAVAIANSLLDAAENIKKC
KYCQSLTEEDICQICSSQSRDESKLCIIESMLDLIAIEEAGFFKGKYFVLNGRISPLDGI
GPNELKLDILEQIITDRDISEIILAISPTVEGETTAHFISQMIDKSIKISRIGFGVPFGG
ELEYLDQQTLIHAFNARTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggacagtaagatattctctcctaaaatcactgctgtaatggagtctttacgtaaatta
ccaactattggtaaaaaatcatcacaaagactcactttacacctgcttgataagtctcca
gaaacggctgttgcaattgctaactcactcttagatgcggctgaaaacatcaaaaaatgt
aaatattgccaatctcttacagaagaagacatttgtcagatttgtagtagccaaagtaga
gatgaatctaaattatgtattattgagagtatgctagacctgattgctatcgaagaagct
ggttttttcaaagggaagtactttgtactaaatggtagaatatctcctcttgatggtatc
ggaccaaacgagctcaaacttgatatcttagagcaaattattaccgatagagatatcagt
gaaatcatcttggcaattagtcctaccgtagagggagagacaacagctcactttatttcc
caaatgattgataaaagtataaaaatctctagaattggatttggtgtcccttttggtggt
gaattagaatacttagaccaacaaacattaatccatgcttttaatgctaggactaacatt
taa

DBGET integrated database retrieval system