KEGG   Francisella sp. TX077308: F7308_1129Help
Entry
F7308_1129        CDS       T01560                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
frt  Francisella sp. TX077308
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:frt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    F7308_1129
DNA repair and recombination proteins [BR:frt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      F7308_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1159377..1159979)
Genome map
AA seq 200 aa AA seqDB search
MDSKIFSPKITAVMESLRKLPTIGKKSSQRLTLHLLDKSPETAVAIANSLLDAAENIKKC
KYCQSLTEEDICQICSSQSRDESKLCIIESMLDLIAIEEAGFFKGKYFVLNGRISPLDGI
GPNELKLDILEQIITDRDISEIILAISPTVEGETTAHFISQMIDKSIKISRIGFGVPFGG
ELEYLDQQTLIHAFNARTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggacagtaagatattctctcctaaaatcactgctgtaatggagtctttacgtaaatta
ccaactattggtaaaaaatcatcacaaagactcactttacacctgcttgataagtctcca
gaaacggctgttgcaattgctaactcactcttagatgcggctgaaaacatcaaaaaatgt
aaatattgccaatctcttacagaagaagacatttgtcagatttgtagtagccaaagtaga
gatgaatctaaattatgtattattgagagtatgctagacctgattgctatcgaagaagct
ggttttttcaaagggaagtactttgtactaaatggtagaatatctcctcttgatggtatc
ggaccaaacgagctcaaacttgatatcttagagcaaattattaccgatagagatatcagt
gaaatcatcttggcaattagtcctaccgtagagggagagacaacagctcactttatttcc
caaatgattgataaaagtataaaaatctctagaattggatttggtgtcccttttggtggt
gaattagaatacttagaccaacaaacattaatccatgcttttaatgctaggactaacatt
taa

DBGET integrated database retrieval system