KEGG   Francisella sp. TX077308: F7308_1178Help
Entry
F7308_1178        CDS       T01560                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
frt  Francisella sp. TX077308
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F7308_1178
  Amino acid metabolism
   00340 Histidine metabolism
    F7308_1178
Enzymes [BR:frt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     F7308_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207424..1208722
Genome map
AA seq 432 aa AA seqDB search
MIEIYNWQELSLAKQAELLSRPVSANKATLVAGVRNILNEVKQNGDKALLEFTSKFDGVD
LDNIEVSADEIKKAYSLVSQDDIELVKNSIARISNYHEVMKPKTTVCDTNDDVVCKKIYK
PIEKVGLYVPGGSAPLVSTLIMLAAPAQIAGCKEIYVTTPCDKEGNIHPLILIAADICKV
SKIYKLGGAQAIAALAYGTETVSKVNKIYGPGNSWVTEAKQQVSNDSQGAAIDLPAGPSE
VLVVADEVADPRFVAADLLAQAEHGTDSQALLITTSQILADKVRDEVSKQTSTAQRKAII
EKSLENSTIIVVDTLSQAINIANEYASEHLILNIENADNYIDSIENAGAVFVGPWAAEAL
GDYITGSNHVLPTYGYAKAYSGLATIDFMKAISIQNVSKQGIKNIGQIAMRLADIEGLKA
HENAIAIRLESL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatatataattggcaagaacttagtctagcaaagcaagcagagcttctatct
cgtccagtttctgctaataaagcaaccttagttgcaggtgttagaaatattttaaatgaa
gttaagcagaatggtgacaaagctcttttagagtttacttctaagtttgatggtgttgat
ttagataatattgaagtctcagcagatgagattaaaaaagcttattcattagtttcacaa
gatgatattgagttagttaaaaactctattgcgcgtatatctaactatcatgaggtaatg
aaaccaaaaacaactgtttgtgatactaatgatgatgtggtttgtaaaaaaatctataag
cctatcgaaaaggttggtctgtatgtacctggtggttcagcacctttagtttctacgcta
ataatgttagcagctccagcgcaaattgcaggttgtaaagagatttatgtaactactcct
tgtgataaagaaggcaatatccatccattaattttaatagcagctgatatttgtaaggtt
tcaaagatttataaattaggtggcgctcaagctatagctgctctagcttatggtacagaa
actgtatccaaagttaataaaatttatggccctggaaattcttgggttacagaggcaaaa
caacaagtatctaatgatagccaaggtgcggctattgatctaccagctggaccttcagag
gttttagtagttgctgatgaagttgctgatcctagatttgttgctgcagatctattagct
caagctgagcatggcacagactcacaagccttattaattacaactagtcaaattttagca
gataaggttagagatgaagtttctaagcaaactagtacagcccaaagaaaagctatcatc
gaaaaatctttagaaaatagcacaattattgttgtagacacacttagccaagcaattaat
atagctaatgagtatgcttctgagcaccttattttaaatattgagaatgcagataattat
attgatagtatcgaaaatgcaggagctgtatttgtaggtccttgggcggctgaagcatta
ggtgattacattacaggatctaatcatgtgttacctacttatggatatgcaaaagcctat
agcggtttagcaactatagattttatgaaagctataagtatccaaaatgtatcaaaacaa
ggtataaaaaatataggtcaaatagcaatgagattagctgatatagaaggtctcaaagct
catgaaaatgcaatagctattcgtttggagagtttataa

DBGET integrated database retrieval system