KEGG   Francisella sp. TX077308: F7308_1227Help
Entry
F7308_1227        CDS       T01560                                 

Definition
cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC:1.8.1.8)
Orthology
K04084  
thiol:disulfide interchange protein DsbD [EC:1.8.1.8]
Organism
frt  Francisella sp. TX077308
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258133..1260007)
Genome map
AA seq 624 aa AA seqDB search
MLQKTKLFYVLILVGIGVLLSSFANASATQQNLIANAIDSITPGSMSLADKSMLKQYSVD
RNFQLQVKILNENTLIATWNIKPGNYLYLKNFSFYSLTPQQVNIQKVIFPKTYNIKNDPF
YGRIKIYKDSVAIKLKISRSNKTINKLPLVIAYQGCSESGICFAPIQQKFNLDLSSTNKI
YEGEEYFGQLPKELQKKLDVTHSNIGDSDYTSFLSHTNIVWAFLIFFGLGLLLTFTPCVL
PLLPIISSIVTGQKQLTTTKAFSISLSYVLGMAISYAVVGVLAGIFGGGIQNILQTPWTI
GAIALLFVVMAVAMFGVFELKIPSFILSSVNNLSSKQKSGTYIGVFIMGILSTLIVSTCV
TAPLVAVLAYISYSGNAVYGGLILFAMGLGMGVPILIVGTTSGSILPKAGNWMHTVKHIS
GFMLLGLAIYMLSKIIPARLTLLLTGILILSLAVYSGAFSFYIKTASAKVRQLFAYIFLI
YGSTLLIGFLMGNTSIIEPLGATTAQINQPQLEFEQVTNSKQLHRALEKVKKQGKPVIVD
YYANWCLDCQYMKHTTFADPKVINKLKNYKLIQANVTDVGQDSSKLLKEFNLFGPPSVII
FDQKGHKEKSIVGKVNAKELLSSI
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgttacagaaaacaaagttattttatgttttaatattagttggaataggtgttttatta
tctagctttgctaatgcttcagccacgcaacaaaacctaatagctaatgcaatcgatagc
attactccaggctcaatgagtctagctgataaaagtatgttaaagcaatacagtgttgat
aggaattttcaattacaagtcaaaattcttaatgaaaatactttaatagcaacatggaat
attaagccaggcaattatctgtatttaaagaattttagtttttatagcctaaccccacaa
caagtcaatattcaaaaggttatttttcctaagacatacaatattaaaaatgatcctttt
tatgggcgaataaagatttataaagatagtgtagctattaagctaaaaattagtagaagc
aataaaactattaataaattaccactagttattgcttatcaaggttgttctgaaagtggt
atttgttttgctcctattcagcaaaaatttaaccttgatttatcatcaactaacaaaatt
tacgagggtgaagaatattttggccagttacctaaagagcttcagaaaaaattagatgtt
acacattcaaatattggagatagcgattatacaagttttttaagtcatacaaatattgtt
tgggcatttttgatattttttggcttaggtttgttattgacatttacaccttgtgtttta
ccgctattaccaatcatctcaagtattgttactggacaaaagcaattaacgacaacaaaa
gcatttagcatttcattatcttatgttttagggatggcaattagttatgcagtagttggg
gtattagcaggaatttttggaggtggtatccaaaatatacttcaaacaccatggacaatt
ggggctatagcattattgtttgtggttatggctgtggcaatgtttggagtttttgaatta
aaaataccatcattcatacttagttctgtaaataatctaagtagtaaacaaaaaagcggc
acctatattggcgtatttataatgggtatattgtcaacattgattgtttcaacttgtgta
acagctcctttggtagcagtactagcttatattagctattcgggtaacgccgtttatgga
ggacttatcttatttgcgatggggcttggtatgggtgtgccaatcttaattgtgggaaca
actagtggctcaatcttaccaaaagctggtaattggatgcatacggtcaagcatatatcc
ggatttatgctacttggattagcaatttatatgttatcaaaaattatccctgcacgatta
actctattgctaaccgggattttgattttaagcttagcagtttactcaggtgcatttagt
ttttatatcaaaacagcatccgcaaaagtaaggcaactttttgcttatatatttttgatt
tacggaagcacattattaattggatttctaatgggtaatacaagtattattgaaccttta
ggagctacaacagctcaaataaaccaaccacaactagagtttgagcaagttactaattca
aaacaattgcatagagctttagaaaaagttaaaaaacaaggtaagcctgttattgttgac
tattatgcaaactggtgtttggactgtcagtatatgaagcatacaacttttgcagatcca
aaagtgattaataagcttaaaaattacaaattaattcaagctaacgttaccgatgttgga
caggatagtagcaagttattgaaagagtttaatctttttggaccacctagcgtgattatt
tttgaccaaaagggacataaagagaaaagtattgttggtaaagtcaatgctaaagagcta
ctaagctcaatctaa

DBGET integrated database retrieval system