KEGG   Francisella sp. TX077308: F7308_1246Help
Entry
F7308_1246        CDS       T01560                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
frt  Francisella sp. TX077308
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:frt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:frt00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1281147..1282145
Genome map
AA seq 332 aa AA seqDB search
MLKVSTRRIKTAPNFLNVISLENDNIQLELLDIGATVYSLRIRNNSGKFENIVLQYADIE
NYFNNPSYYGASIGRVAGRIKDGQFILNNKKYSVSKNEKSINTLHGSFNNISHQRFDYTV
NQNKVKFSRIQKSSDDGFPADVQIDITYELQENSLIIYFEAIANEDTLLNLTNHNYYNLS
GDFKATIENHKLQVSAKRVVITDTNSIPKQIIKIPYEMDFSQESVIADKLETNFEYFSGG
GIDHCYIIDGAIKLTDEISGRKLVATSSYPATQIYTTNFPDGLKLSNGLNSQKFHAICFE
PQFVPVIGKNYDKSDIKLKKGQQYKQFIKLKF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagtatctactagaagaattaaaactgcaccaaacttcctaaatgtaatttca
ttagaaaatgataatatccaattagaactattagatattggagctactgtatattctctt
agaattagaaataacagtggtaagtttgaaaatatagtcttacagtatgcagatatagaa
aattattttaataatccatcatattatggtgctagtatcggtagggtagctgggagaatc
aaagatggtcagtttatcttaaataataaaaagtatagtgttagtaaaaatgagaaatct
attaatactcttcatggaagttttaataatatctctcatcagcgatttgattatacagtt
aatcaaaataaagttaaatttagtcgtattcaaaaatcatcagatgatggttttccagca
gatgtacagattgatataacttatgaattacaagaaaattcactaataatctattttgaa
gctatagctaatgaagatacattattaaatctcacaaaccacaattactataatttatct
ggagattttaaagctactatagaaaatcataaactacaagtatctgcaaagagagtagta
ataactgatacgaacagtatacctaagcaaattataaaaattccttatgaaatggatttt
agtcaagaatcagttattgcagataaattagaaactaattttgaatattttagtggtggt
gggatagatcattgttatattattgatggggctattaaattgacagatgagatcagtgga
cgaaagcttgtagcaacaagttcttatccagctacgcagatatatactactaattttcct
gatggtttgaagttatcaaatggtttaaattcacagaaatttcatgcaatatgttttgag
ccacagtttgtaccagtaattggcaaaaactatgataagtcagatattaagctcaagaaa
gggcagcaatataagcaatttattaagcttaaattttag

DBGET integrated database retrieval system