KEGG   Francisella sp. TX077308: F7308_1306Help
Entry
F7308_1306        CDS       T01560                                 

Definition
Flavohemoprotein (EC:1.14.12.17)
Orthology
K05916  
nitric oxide dioxygenase [EC:1.14.12.17]
Organism
frt  Francisella sp. TX077308
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339264..1340439
Genome map
AA seq 391 aa AA seqDB search
MLSQKNIDTIKATIPVLEENGVALTKHFYDRMFKHNPEVKKFFNTSRQKNSSQPEALAAA
ILAYAKNIENLEVLGNAVELIAQKHASLQIKAEHYPVVGSNLIESIKEVLNLNDNDDIVI
AWTAAYNLLAEILINREKSIYKENLEQYGWDNFKEFEVVKKENESINTYSFYFKNDLFRR
YDFKPGQYITVRVPYNGMTTMRNYSISSATGEDYLRITVKQEGQGYVSQYLSHEIKVGDK
IEIAPPCGEFFLEVNKNLDKPIVFISAGIGITPLMSMLLSELKTQNRRQVLFVCGKKNKN
EHPFAKLLEKLSSENPRLKTIFFYEDNSGSDAKQGLVCIDTVQQHISEGKNDAQYFFCGP
KEFMLSIHEKLLKNGVREKNIHYEFFGSKTV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttaagccaaaagaatatagatactataaaagcaacaattcctgttttagaagaaaat
ggagttgctttaacaaaacatttctatgatagaatgtttaagcataatcccgaagttaaa
aagttttttaatacctcaagacaaaaaaactcatctcaaccagaagctttagctgcagca
attttggcttatgcaaaaaatattgagaatcttgaagttttaggcaatgcagtagagcta
atagcccaaaaacatgcatcattacaaatcaaagcggagcattatccagtagtaggttct
aacttaatcgaatcaatcaaagaggttctaaacttaaatgataatgatgacatagttata
gcttggacagcagcctacaatttattagctgaaattttgattaatcgtgaaaagagtata
tacaaagagaatttagagcagtatggttgggataattttaaagagtttgaggtagtcaaa
aaagaaaatgagagtataaatacatattctttctattttaaaaatgatctttttagaaga
tatgatttcaaaccaggacaatatattactgttagagttccatataatggaatgactact
atgagaaattatagtatttcttcagctactggtgaggattatctaagaataacagttaaa
caagaggggcaaggttatgtatctcaatacctatcgcatgagataaaagttggtgacaaa
atagaaatagcacctccttgtggcgaatttttcttggaagtaaataaaaatcttgataaa
ccgatagtttttatttcagcaggaatcggtattacacctttaatgagtatgcttttatcg
gagctaaaaacacaaaatcgaagacaagtactttttgtttgtggtaagaaaaacaaaaat
gagcatccttttgctaagctgttagaaaaactatcaagtgagaacccaagacttaaaact
atttttttctatgaagataattctggatctgatgcaaagcaaggactagtctgtatagat
actgtccaacaacacattagtgaaggtaagaatgatgctcaatacttcttttgtggacct
aaagaatttatgctttctatacatgaaaagttattaaaaaatggcgttagagaaaaaaat
attcattatgaattctttggttcaaaaacagtttaa

DBGET integrated database retrieval system