KEGG   Francisella sp. TX077308: F7308_1306Help
Entry
F7308_1306        CDS       T01560                                 

Definition
Flavohemoprotein (EC:1.14.12.17)
Orthology
K05916  
nitric oxide dioxygenase [EC:1.14.12.17]
Organism
frt  Francisella sp. TX077308
Brite
Enzymes [BR:frt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     F7308_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339264..1340439
Genome map
AA seq 391 aa AA seqDB search
MLSQKNIDTIKATIPVLEENGVALTKHFYDRMFKHNPEVKKFFNTSRQKNSSQPEALAAA
ILAYAKNIENLEVLGNAVELIAQKHASLQIKAEHYPVVGSNLIESIKEVLNLNDNDDIVI
AWTAAYNLLAEILINREKSIYKENLEQYGWDNFKEFEVVKKENESINTYSFYFKNDLFRR
YDFKPGQYITVRVPYNGMTTMRNYSISSATGEDYLRITVKQEGQGYVSQYLSHEIKVGDK
IEIAPPCGEFFLEVNKNLDKPIVFISAGIGITPLMSMLLSELKTQNRRQVLFVCGKKNKN
EHPFAKLLEKLSSENPRLKTIFFYEDNSGSDAKQGLVCIDTVQQHISEGKNDAQYFFCGP
KEFMLSIHEKLLKNGVREKNIHYEFFGSKTV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttaagccaaaagaatatagatactataaaagcaacaattcctgttttagaagaaaat
ggagttgctttaacaaaacatttctatgatagaatgtttaagcataatcccgaagttaaa
aagttttttaatacctcaagacaaaaaaactcatctcaaccagaagctttagctgcagca
attttggcttatgcaaaaaatattgagaatcttgaagttttaggcaatgcagtagagcta
atagcccaaaaacatgcatcattacaaatcaaagcggagcattatccagtagtaggttct
aacttaatcgaatcaatcaaagaggttctaaacttaaatgataatgatgacatagttata
gcttggacagcagcctacaatttattagctgaaattttgattaatcgtgaaaagagtata
tacaaagagaatttagagcagtatggttgggataattttaaagagtttgaggtagtcaaa
aaagaaaatgagagtataaatacatattctttctattttaaaaatgatctttttagaaga
tatgatttcaaaccaggacaatatattactgttagagttccatataatggaatgactact
atgagaaattatagtatttcttcagctactggtgaggattatctaagaataacagttaaa
caagaggggcaaggttatgtatctcaatacctatcgcatgagataaaagttggtgacaaa
atagaaatagcacctccttgtggcgaatttttcttggaagtaaataaaaatcttgataaa
ccgatagtttttatttcagcaggaatcggtattacacctttaatgagtatgcttttatcg
gagctaaaaacacaaaatcgaagacaagtactttttgtttgtggtaagaaaaacaaaaat
gagcatccttttgctaagctgttagaaaaactatcaagtgagaacccaagacttaaaact
atttttttctatgaagataattctggatctgatgcaaagcaaggactagtctgtatagat
actgtccaacaacacattagtgaaggtaagaatgatgctcaatacttcttttgtggacct
aaagaatttatgctttctatacatgaaaagttattaaaaaatggcgttagagaaaaaaat
attcattatgaattctttggttcaaaaacagtttaa

DBGET integrated database retrieval system