KEGG   Francisella sp. TX077308: F7308_1312Help
Entry
F7308_1312        CDS       T01560                                 

Definition
(GenBank) Hypothetical sugar kinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
frt  Francisella sp. TX077308
Pathway
frt00010  Glycolysis / Gluconeogenesis
frt00052  Galactose metabolism
frt00500  Starch and sucrose metabolism
frt00520  Amino sugar and nucleotide sugar metabolism
frt00521  Streptomycin biosynthesis
frt01100  Metabolic pathways
frt01110  Biosynthesis of secondary metabolites
frt01120  Microbial metabolism in diverse environments
frt01130  Biosynthesis of antibiotics
frt01200  Carbon metabolism
Module
frt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7308_1312
   00052 Galactose metabolism
    F7308_1312
   00500 Starch and sucrose metabolism
    F7308_1312
   00520 Amino sugar and nucleotide sugar metabolism
    F7308_1312
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    F7308_1312
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    F7308_1312
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     F7308_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEI36238
UniProt: F8G7L1
Position
1346386..1347270
Genome map
AA seq 294 aa AA seqDB search
MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVIDTIA
KVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAKFKVPVFIDNDANCF
AIGQRLYGKGKEHENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGIEGVEILKRARNNDKDALGIYKQFGKHLGVAIKSIMYTLDPKVIIIAGSI
MSAREYFEKAMWDEIKTFAFTQSAKKIKIEWSETEGGFQVFGAAAVYLDRSSNL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaattcaaattaagaatagaactgtggttggtgttgatatcggtggcact
aaagtgaatgctggtagggtatgtggagaaaatttattagactcttacttgagcaaaatt
ccgccagatgcagaacataatgctcaatctgttattgatgttgtcatcgatactatagca
aaagtttttacatctgaagttgagggcataggcgttggtattcctagtgttgcagatcga
gaaaagggaattgtatatgatgtgcaaaatatcaaatcatggcaagagattcatctaaaa
gaaatactagaggcaaagtttaaagtaccagtttttatagataatgatgctaattgtttt
gctataggtcaaagactatatggtaaaggtaaagagcatgaaaattttgttggtattaca
ataggcacgggtattggtggcggtattatcaataaaggctctttactaaaagactctaat
tgcggagcaggagagtttggcatgttaccatatttagatggaatcttggaggattattgt
agtggccaattctttataaaaaagataggtattgaaggtgttgagatccttaaacgagca
agaaataatgataaagatgctctaggcatctataagcaatttggtaaacatcttggagta
gcaataaagtctataatgtatactttagatccaaaggtgataataattgctggatcaata
atgtcagctagagaatattttgaaaaagcaatgtgggatgagattaaaacatttgccttt
actcagtcagctaaaaaaattaaaatagaatggtcggaaacggaaggtggttttcaagtt
tttggtgctgcagctgtttatttggatcgaagtagcaatttatga

DBGET integrated database retrieval system