KEGG   Francisella sp. TX077308: F7308_1312Help
Entry
F7308_1312        CDS       T01560                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
frt  Francisella sp. TX077308
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_1312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7308_1312
   00052 Galactose metabolism
    F7308_1312
   00500 Starch and sucrose metabolism
    F7308_1312
   00520 Amino sugar and nucleotide sugar metabolism
    F7308_1312
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    F7308_1312
   00524 Butirosin and neomycin biosynthesis
    F7308_1312
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     F7308_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346386..1347270
Genome map
AA seq 294 aa AA seqDB search
MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVIDTIA
KVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAKFKVPVFIDNDANCF
AIGQRLYGKGKEHENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGIEGVEILKRARNNDKDALGIYKQFGKHLGVAIKSIMYTLDPKVIIIAGSI
MSAREYFEKAMWDEIKTFAFTQSAKKIKIEWSETEGGFQVFGAAAVYLDRSSNL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaattcaaattaagaatagaactgtggttggtgttgatatcggtggcact
aaagtgaatgctggtagggtatgtggagaaaatttattagactcttacttgagcaaaatt
ccgccagatgcagaacataatgctcaatctgttattgatgttgtcatcgatactatagca
aaagtttttacatctgaagttgagggcataggcgttggtattcctagtgttgcagatcga
gaaaagggaattgtatatgatgtgcaaaatatcaaatcatggcaagagattcatctaaaa
gaaatactagaggcaaagtttaaagtaccagtttttatagataatgatgctaattgtttt
gctataggtcaaagactatatggtaaaggtaaagagcatgaaaattttgttggtattaca
ataggcacgggtattggtggcggtattatcaataaaggctctttactaaaagactctaat
tgcggagcaggagagtttggcatgttaccatatttagatggaatcttggaggattattgt
agtggccaattctttataaaaaagataggtattgaaggtgttgagatccttaaacgagca
agaaataatgataaagatgctctaggcatctataagcaatttggtaaacatcttggagta
gcaataaagtctataatgtatactttagatccaaaggtgataataattgctggatcaata
atgtcagctagagaatattttgaaaaagcaatgtgggatgagattaaaacatttgccttt
actcagtcagctaaaaaaattaaaatagaatggtcggaaacggaaggtggttttcaagtt
tttggtgctgcagctgtttatttggatcgaagtagcaatttatga

DBGET integrated database retrieval system